UniGene Name: sp_v3.0_unigene72812
Length: 213 nt
UniGene Fasta |
---|
>sp_v3.0_unigene72812
C |
Ace file of the UniGene sp_v3.0_unigene72812 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | cytochrome P450, family 72, subfamily A, polypeptide 9 [Arabidopsis thaliana] gb|AEE75549.1| cytochrome P450, family 72, subfamily A, polypeptide 9 [Arabidopsis thaliana] | - | - | 1.0e-17 | 61% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 70% |
Sma3 | Chromosome undetermined scaffold_102, whole genome shotgun sequence | - | - | 2.15e-11 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Secologanin synthase. | EC:1.3.3.9 | - | 9.281e-08 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Monoterpenoid biosynthesis | 00902 | 9.281e-08 | % | |
Sma3 | Biosynthesis of terpenoids and steroids | 01062 | 9.281e-08 | % | |
Sma3 | Biosynthesis of alkaloids derived from terpenoid and polyketide | 01066 | 9.281e-08 | % | |
Sma3 | Metabolic pathways | 01100 | 9.281e-08 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 9.281e-08 | % |
Source | Gene names |
---|---|
Sma3 | At3g14610; At3g14610/MIE1.11; CYP72A18; CYP72A42v3; CYP72A43; CYP72A44; CYP72A45Pv1; CYP72A47; CYP72A59; CYP72A84; CYP749A1v1; CYP749A1v2; CYP749A1v3; CYP749A6; GSVIVT00000150001; GSVIVT00000171001; GSVIVT00000189001; GSVIVT00000202001; GSVIVT00000208001; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | endoplasmic reticulum | GO:0005783 | Cellular Component | 0.0 | - |
Sma3 | monooxygenase activity | GO:0004497 | Molecular Function | 0.0 | - |
Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Cytochrome P450 | IPR001128 | - | 0.0 | - |
Sma3 | Cytochrome P450, E-class, group I | IPR002401 | - | 0.0 | - |
Sma3 | Cytochrome P450, conserved site | IPR017972 | - | 0.0 | - |
Sma3 | IPR017973 | - | 0.0 | - | |
Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G14630.1 | CYP72A9 cytochrome P450, family 72, subfamily A, polypeptide 9 chr3:4917498-4919409 FORWARD LENGTH=508 | 5.0e-23 | 61% |
RefSeq | Arabidopsis thaliana | NP_188081.1 | cytochrome P450, family 72, subfamily A, polypeptide 9 [Arabidopsis thaliana] | 6.0e-23 | 61% |
RefSeq | Populus trichocarpa | XP_002332521.1 | cytochrome P450 [Populus trichocarpa] | 5.0e-24 | 57% |
Full-Lengther Next Prediction |
---|
Fln status: Putative C-terminus
Fln database: coniferopsida.fasta
Fln subject: A9NWW9
Fln msg: STOP codon was not found. Distance to subject end: 0 aas, your sequence is shorter than subject: 70 - 517
Fln protein:
V
Protein Length:
71
Fln nts:
C
Fln Alignment:
GG46A6U02J00TN___FMPFGLGPRICVGMNFSMIEAKVALAMMLQRFSFALSPAYAHAPVQIFTIRPLHGGQLVLH
A9NWW9_______________FMPFGFGPRICVGQNFALLEAKVVLAMILQRFSFVTSPSYAHAPVMVVTVRPQHGAQVILH
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain