UniGene Name: sp_v3.0_unigene72806
Length: 224 nt
UniGene Fasta |
---|
>sp_v3.0_unigene72806
C |
Ace file of the UniGene sp_v3.0_unigene72806 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | DNA polymerase (Fragment) n=2 Tax=Spermatophyta RepID=D7U4B5_VITVI | - | - | 4.0e-18 | 78% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 88% |
Sma3 | DNA polymerase | - | - | 3.515e-23 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | DNA-directed DNA polymerase. | EC:2.7.7.7 | - | 8.008e-25 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Purine metabolism | 00230 | 8.008e-25 | % | |
Sma3 | Pyrimidine metabolism | 00240 | 8.008e-25 | % | |
Sma3 | Metabolic pathways | 01100 | 8.008e-25 | % |
Source | Gene names |
---|---|
Sma3 | CHLREDRAFT_189721; GSVIVT00006013001; LOC_Os11g08330; MICPUCDRAFT_46825; MICPUN_97378; OSTLU_44713; Os11g0186400; OsI_35393; OsI_35398; OsJ_33228; Ot02g05840; PHYPADRAFT_159627; POLD1; POPTRDRAFT_207140; RCOM_1551270; polD; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | nucleotide binding | GO:0000166 | Molecular Function | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | DNA-directed DNA polymerase activity | GO:0003887 | Molecular Function | 0.0 | - |
Sma3 | exonuclease activity | GO:0004527 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | DNA replication | GO:0006260 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | DNA-directed DNA polymerase, family B, pol2 | IPR004578 | - | 0.0 | - |
Sma3 | DNA-directed DNA polymerase, family B, exonuclease domain | IPR006133 | - | 0.0 | - |
Sma3 | DNA-directed DNA polymerase, family B, multifunctional domain | IPR006134 | - | 0.0 | - |
Sma3 | DNA-directed DNA polymerase, family B | IPR006172 | - | 0.0 | - |
Sma3 | DNA-directed DNA polymerase, family B, conserved site | IPR017964 | - | 0.0 | - |
Sma3 | IPR017966 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G63960.2 | " DNA binding;nucleotide binding;nucleic acid binding;DNA-directed DNA polymerases;DNA-directed DNA polymerases chr5:25599597-25606672 FORWARD LENGTH=1112" | 2.0e-21 | 74% |
RefSeq | Arabidopsis thaliana | NP_201201.2 | DNA polymerase delta subunit 1 [Arabidopsis thaliana] | 3.0e-21 | 74% |
RefSeq | Populus trichocarpa | XP_002307042.1 | predicted protein, partial [Populus trichocarpa] | 9.0e-22 | 74% |
Full-Lengther Next Prediction |
---|
Fln status: C-terminus
Fln database: coniferopsida.fasta
Fln subject: D5AEH5
Fln msg: your sequence is shorter than subject: 51 - 228
Fln protein:
R
Protein Length:
52
Fln nts:
C
Fln Alignment:
GG46A6U02JBCCU___FGKLWTQCQRCEGSLHQDVLCTSDDCPIFYRRNKALKDLTEA*VQLERWQF
D5AEH5_______________FGKLWTQCQRCQASLHQDVLCTSRDCPIFYRRKKAQKDLTEAEVQLERWQF
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain