UniGene Name: sp_v3.0_unigene72796
Length: 156 nt
![]() |
---|
>sp_v3.0_unigene72796
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Ubiquitin carrier protein (Fragment) n=2 Tax=Magnoliophyta RepID=Q677E9_HYAOR | - | - | 7.0e-18 | 97% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 97% |
Sma3 | Ubiquitin carrier protein | - | - | 2.542e-19 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Ligases, Forming carbon-nitrogen bonds, Acid--D-amino-acid ligases (peptide synthases). | EC:6.3.2.- | - | 7.088e-16 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Tryptophan metabolism | 00380 | 7.088e-16 | % | |
Sma3 | Biosynthesis of siderophore group nonribosomal peptides | 01053 | 7.088e-16 | % |
Source | Gene names |
---|---|
Sma3 | At1g14400; At2g02760; At5g62540; CHLREDRAFT_132836; F14L17.17; F14L17_35; GSVIVT00000109001; GSVIVT00020897001; GSVIVT00027085001; GSVIVT00029008001; HUPB901; HUPB902; HUPB903; K19B1.15; LOC_Os03g57790; MICPUCDRAFT_27434; MICPUCDRAFT_33249; MICPUN_92203; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | endonuclease activity | GO:0004519 | Molecular Function | 0.0 | - |
Sma3 | ubiquitin-protein ligase activity | GO:0004842 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | small conjugating protein ligase activity | GO:0019787 | Molecular Function | 0.0 | - |
Sma3 | 4 iron, 4 sulfur cluster binding | GO:0051539 | Molecular Function | 0.0 | - |
Sma3 | base-excision repair | GO:0006284 | Biological Process | 0.0 | - |
Sma3 | ubiquitin-dependent protein catabolic process | GO:0006511 | Biological Process | 0.0 | - |
Sma3 | negative regulation of flower development | GO:0009910 | Biological Process | 0.0 | - |
Sma3 | leaf morphogenesis | GO:0009965 | Biological Process | 0.0 | - |
Sma3 | protein ubiquitination | GO:0016567 | Biological Process | 0.0 | - |
Sma3 | histone H2B ubiquitination | GO:0033523 | Biological Process | 0.0 | - |
Sma3 | post-translational protein modification | GO:0043687 | Biological Process | 0.0 | - |
Sma3 | regulation of protein metabolic process | GO:0051246 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | NUDIX hydrolase domain | IPR000086 | - | 0.0 | - |
Sma3 | Helix-hairpin-helix motif | IPR000445 | - | 0.0 | - |
Sma3 | Ubiquitin-conjugating enzyme, E2 | IPR000608 | - | 0.0 | - |
Sma3 | HhH-GPD domain | IPR003265 | - | 0.0 | - |
Sma3 | Endonuclease III-like, iron-sulphur cluster loop motif | IPR003651 | - | 0.0 | - |
Sma3 | Endonuclease III, iron-sulphur binding site | IPR004035 | - | 0.0 | - |
Sma3 | IPR015582 | - | 0.0 | - | |
Sma3 | Ubiquitin-conjugating enzyme/RWD-like | IPR016135 | - | 0.0 | - |
Sma3 | WD40 repeat, conserved site | IPR019775 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G02760.1 | ATUBC2, UBC2 ubiquiting-conjugating enzyme 2 chr2:774271-775149 FORWARD LENGTH=152 | 2.0e-25 | 97% |
RefSeq | Arabidopsis thaliana | NP_973825.1 | ubiquitin-conjugating enzyme E2 1 [Arabidopsis thaliana] | 2.0e-25 | 97% |
RefSeq | Populus trichocarpa | XP_002325860.1 | histone ubiquitination proteins group [Populus trichocarpa] | 2.0e-25 | 97% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NMK1
Fln msg: Distance to subject end: 36 aas, your sequence is shorter than subject: 52 - 152
Fln protein:
R
Protein Length:
53
Fln nts:
C
Fln Alignment:
GG46A6U02G72M6___VSRVFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDP
A9NMK1_______________VSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDP
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain