UniGene Name: sp_v3.0_unigene72774
Length: 203 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene72774
C |
Ace file of the UniGene sp_v3.0_unigene72774
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Aldehyde dehydrogenase, mitochondrial n=1 Tax=Phytophthora infestans T30-4 RepID=D0MV13_PHYIT | - | - | 4.0e-19 | 75% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 89% |
| Sma3 | Aldehyde dehydrogenase | - | - | 8.127e-35 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Aldehyde dehydrogenase (NAD(+)). | EC:1.2.1.3 | - | 2.86e-17 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glycolysis / Gluconeogenesis | 00010 | 2.86e-17 | % | |
| Sma3 | Pentose and glucuronate interconversions | 00040 | 2.86e-17 | % | |
| Sma3 | Ascorbate and aldarate metabolism | 00053 | 2.86e-17 | % | |
| Sma3 | Fatty acid metabolism | 00071 | 2.86e-17 | % | |
| Sma3 | Valine, leucine and isoleucine degradation | 00280 | 2.86e-17 | % | |
| Sma3 | Lysine degradation | 00310 | 2.86e-17 | % | |
| Sma3 | Arginine and proline metabolism | 00330 | 2.86e-17 | % | |
| Sma3 | Histidine metabolism | 00340 | 2.86e-17 | % | |
| Sma3 | Tryptophan metabolism | 00380 | 2.86e-17 | % | |
| Sma3 | beta-Alanine metabolism | 00410 | 2.86e-17 | % | |
| Sma3 | Glycerolipid metabolism | 00561 | 2.86e-17 | % | |
| Sma3 | Pyruvate metabolism | 00620 | 2.86e-17 | % | |
| Sma3 | Chloroalkane and chloroalkene degradation | 00625 | 2.86e-17 | % | |
| Sma3 | Propanoate metabolism | 00640 | 2.86e-17 | % | |
| Sma3 | Limonene and pinene degradation | 00903 | 2.86e-17 | % | |
| Sma3 | Metabolic pathways | 01100 | 2.86e-17 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 2.86e-17 | % | |
| Sma3 | Retinal dehydrogenase. | EC:1.2.1.36 | - | 1.764e-10 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Retinol metabolism | 00830 | 1.764e-10 | % | |
| Sma3 | Metabolic pathways | 01100 | 1.764e-10 | % |
| Source | Gene names |
|---|---|
| Sma3 | ALD1; ALDH; ALDH1a; ALDH2; ALDH2A; ALDH2B; ALDH2B4; ALDH2B7; ALDH2C4; ALDH2a; ALDH2b; ALDH3; Aldh; Aldh1; Aldh2a; Aldh2b; At1g23800; At3g24503; At3g48000; CHLREDRAFT_135609; F5O8.33; F5O8.35; GSVIVT00016121001; GSVIVT00020768001; GSVIVT00028844001; GSVIVT |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | mitochondrial matrix | GO:0005759 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | aldehyde dehydrogenase (NAD) activity | GO:0004029 | Molecular Function | 0.0 | - |
| Sma3 | aldehyde dehydrogenase [NAD(P)+] activity | GO:0004030 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
| Sma3 | coniferyl-aldehyde dehydrogenase activity | GO:0050269 | Molecular Function | 0.0 | - |
| Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
| Sma3 | phenylpropanoid biosynthetic process | GO:0009699 | Biological Process | 0.0 | - |
| Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Aldehyde dehydrogenase domain | IPR015590 | - | 0.0 | - |
| Sma3 | Aldehyde dehydrogenase, conserved site | IPR016160 | - | 0.0 | - |
| Sma3 | Aldehyde dehydrogenase, N-terminal | IPR016162 | - | 0.0 | - |
| Sma3 | Aldehyde dehydrogenase, C-terminal | IPR016163 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G24503.1 | ALDH2C4, ALDH1A, REF1 aldehyde dehydrogenase 2C4 chr3:8919732-8923029 REVERSE LENGTH=501 | 3.0e-19 | 64% |
| RefSeq | Arabidopsis thaliana | NP_566749.1 | aldehyde dehydrogenase 2C4 [Arabidopsis thaliana] | 4.0e-19 | 64% |
| RefSeq | Populus trichocarpa | XP_002324977.1 | predicted protein [Populus trichocarpa] | 1.0e-19 | 62% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NV57
Fln msg: Distance to subject end: 80 aas, your sequence is shorter than subject: 67 - 248
Fln protein:
R
Protein Length:
68
Fln nts:
C
Fln Alignment:
GG46A6U02HLP2X___RDGAKLLLGGNSWGDKGFYIEPTIFADVQDDMQIAKEEIFGPVMSILKFKTIEEVIERG
A9NV57_______________RDGAKLLLGGNSLNNKGFYIEPTIFSDVEDDMQIAKEEIFGPVMSILKFKTIEEAIERG

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta