UniGene Name: sp_v3.0_unigene72762
Length: 206 nt
UniGene Fasta |
---|
>sp_v3.0_unigene72762
C |
Ace file of the UniGene sp_v3.0_unigene72762 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Flavine-containing monoxygenase n=1 Tax=Populus trichocarpa RepID=B9H9Q8_POPTR | - | - | 2.0e-16 | 81% |
FL-Next | sp=Flavin-containing monooxygenase YUCCA3; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 66% |
Sma3 | Flavine-containing monoxygenase | - | - | 2.446e-24 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Flavin-containing monooxygenase. | EC:1.14.13.8 | - | 2.39e-15 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Methane metabolism | 00680 | 2.39e-15 | % | |
Sma3 | Drug metabolism - cytochrome P450 | 00982 | 2.39e-15 | % |
Source | Gene names |
---|---|
Sma3 | AT4g13260; AT4g32540; At1g04180; At1g04610; At4g13260; At4g32540; At5g11320; At5g43890; B1340F09.23; Bs3; Bs3-E; F17N18.150; F20D22.5; F2I11_210; FML1; FML2; FML3; FML4; FML5; FML7; FML8; GSVIVT00016745001; GSVIVT00020401001; GSVIVT00024967001; GSVIVT0002 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | monooxygenase activity | GO:0004497 | Molecular Function | 0.0 | - |
Sma3 | N,N-dimethylaniline monooxygenase activity | GO:0004499 | Molecular Function | 0.0 | - |
Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
Sma3 | flavin adenine dinucleotide binding | GO:0050660 | Molecular Function | 0.0 | - |
Sma3 | NADP binding | GO:0050661 | Molecular Function | 0.0 | - |
Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
Sma3 | auxin biosynthetic process | GO:0009851 | Biological Process | 0.0 | - |
Sma3 | positive regulation of flower development | GO:0009911 | Biological Process | 0.0 | - |
Sma3 | inflorescence development | GO:0010229 | Biological Process | 0.0 | - |
Sma3 | cotyledon development | GO:0048825 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Pyridine nucleotide-disulphide oxidoreductase, class-II | IPR000103 | - | 0.0 | - |
Sma3 | CUB | IPR000859 | - | 0.0 | - |
Sma3 | Flavin monooxygenase FMO | IPR000960 | - | 0.0 | - |
Sma3 | Pyridine nucleotide-disulphide oxidoreductase, NAD-binding domain | IPR001327 | - | 0.0 | - |
Sma3 | Lipocalin | IPR002345 | - | 0.0 | - |
Sma3 | Monooxygenase, FAD-binding | IPR002938 | - | 0.0 | - |
Sma3 | 2-oxo acid dehydrogenase, lipoyl-binding site | IPR003016 | - | 0.0 | - |
Sma3 | Fumarate reductase/succinate dehydrogenase flavoprotein, N-terminal | IPR003953 | - | 0.0 | - |
Sma3 | FAD-dependent pyridine nucleotide-disulphide oxidoreductase | IPR013027 | - | 0.0 | - |
Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G04610.1 | YUC3 YUCCA 3 chr1:1279524-1281331 FORWARD LENGTH=437 | 1.0e-21 | 66% |
RefSeq | Arabidopsis thaliana | NP_171955.1 | YUCCA family monooxygenase [Arabidopsis thaliana] | 2.0e-21 | 66% |
RefSeq | Populus trichocarpa | XP_002309594.1 | flavine-containing monoxygenase [Populus trichocarpa] | 3.0e-22 | 81% |
Full-Lengther Next Prediction |
---|
Fln status: Putative C-terminus
Fln database: sp_plants
Fln subject: O23024
Fln msg: STOP codon was not found. Distance to subject end: 14 aas, your sequence is shorter than subject: 68 - 437
Fln protein:
V
Protein Length:
69
Fln nts:
C
Fln Alignment:
GG46A6U02G07FL___SDFFSDDGMPKTPFPDGWKGENGLYSVGFTRRGLLGASLDARRIAQDIGGLLRAGRKQQ
O23024_______________NDFFSDDGIPKNPFPNGWKGEAGLYAVGFTRKGLFGASLDAMSVAHDIANRWKEESKQQ
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain