|
||||||
|
UniGene Name: sp_v3.0_unigene72751
Length: 160 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene72751
C |
|
Ace file of the UniGene sp_v3.0_unigene72751
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | oligopeptidase B [Triticum aestivum] | - | - | 9.0e-11 | 64% |
| FL-Next | tr=Putative uncharacterized protein; Vitis vinifera (Grape). | - | - | 0.0 | 75% |
| Sma3 | Oligopeptidase B, putative | - | - | 1.647e-08 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Oligopeptidase B. | EC:3.4.21.83 | - | 2.744e-08 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g50380; B1206D04.9; F14I3.4; GSVIVT00002597001; GSVIVT00002598001; OPB; OSJNBa0069C14.32; Os06g0730600; OsI_24549; OsJ_22744; PHYPADRAFT_108694; POPTRDRAFT_718074; RCOM_0246170; RCOM_1454200; VITISV_037053; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
| Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
| Sma3 | serine-type endopeptidase activity | GO:0004252 | Molecular Function | 0.0 | - |
| Sma3 | endonuclease activity | GO:0004519 | Molecular Function | 0.0 | - |
| Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
| Sma3 | DNA repair | GO:0006281 | Biological Process | 0.0 | - |
| Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | IPR000097 | - | 0.0 | - | |
| Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
| Sma3 | Peptidase S9, prolyl oligopeptidase, catalytic domain | IPR001375 | - | 0.0 | - |
| Sma3 | Peptidase S9A, prolyl oligopeptidase | IPR002470 | - | 0.0 | - |
| Sma3 | Peptidase S9A/B/C, oligopeptidase, N-terminal beta-propeller | IPR004106 | - | 0.0 | - |
| Sma3 | Endonuclease/exonuclease/phosphatase | IPR005135 | - | 0.0 | - |
| Sma3 | IPR015706 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G50380.1 | Prolyl oligopeptidase family protein chr1:18662480-18666185 FORWARD LENGTH=710 | 7.0e-14 | 64% |
| RefSeq | Arabidopsis thaliana | NP_564567.1 | oligopeptidase B [Arabidopsis thaliana] | 9.0e-14 | 64% |
| RefSeq | Populus trichocarpa | XP_002310359.1 | predicted protein [Populus trichocarpa] | 8.0e-16 | 68% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: tr_plants
Fln subject: F6HVY5
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 111 aas, your sequence is shorter than subject: 52 - 694
Fln protein:
S
Protein Length:
53
Fln nts:
C
Fln Alignment:
GG46A6U02FYAP1___LSLKYTFTDFIACAEYLLNNQFGSKDKICIYGGSAGGLLIGAVLNMRP
F6HVY5_______________LKKRNTFTDFIACAEYLIEMKFCSKEKLCIQGGSAGGLLIGAVLNMRP
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
