UniGene Name: sp_v3.0_unigene72702
Length: 222 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene72702
C |
Ace file of the UniGene sp_v3.0_unigene72702
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Oligopeptide transporter, putative n=1 Tax=Ricinus communis RepID=B9S4B5_RICCO | - | - | 8.0e-14 | 74% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 54% |
| Sma3 | Oligopeptide transporter, putative | - | - | 1.68e-09 | - |
| Source | Gene names |
|---|---|
| Sma3 | At2g40460; At5g46040; At5g46050; GSVIVT00020319001; GSVIVT00028535001; GSVIVT00028536001; GSVIVT00029402001; LOC_Os03g04570; LOC_Os10g33170; MCL19.10; MCL19.9; NRT1-3; OSJNBa0079L16.9; Os03g0138700; Os10g0469900; OsI_09936; OsI_19508; OsI_33983; OsI_33988 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | transporter activity | GO:0005215 | Molecular Function | 0.0 | - |
| Sma3 | dipeptide transporter activity | GO:0042936 | Molecular Function | 0.0 | - |
| Sma3 | tripeptide transporter activity | GO:0042937 | Molecular Function | 0.0 | - |
| Sma3 | oligopeptide transport | GO:0006857 | Biological Process | 0.0 | - |
| Sma3 | response to wounding | GO:0009611 | Biological Process | 0.0 | - |
| Sma3 | response to nematode | GO:0009624 | Biological Process | 0.0 | - |
| Sma3 | response to abscisic acid stimulus | GO:0009737 | Biological Process | 0.0 | - |
| Sma3 | response to salicylic acid stimulus | GO:0009751 | Biological Process | 0.0 | - |
| Sma3 | response to jasmonic acid stimulus | GO:0009753 | Biological Process | 0.0 | - |
| Sma3 | hyperosmotic salinity response | GO:0042538 | Biological Process | 0.0 | - |
| Sma3 | defense response to bacterium | GO:0042742 | Biological Process | 0.0 | - |
| Sma3 | dipeptide transport | GO:0042938 | Biological Process | 0.0 | - |
| Sma3 | tripeptide transport | GO:0042939 | Biological Process | 0.0 | - |
| Sma3 | response to leucine | GO:0043201 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Oligopeptide transporter | IPR000109 | - | 0.0 | - |
| Sma3 | PTR2 family proton/oligopeptide symporter, conserved site | IPR018456 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G40460.1 | Major facilitator superfamily protein chr2:16897123-16901171 FORWARD LENGTH=583 | 1.0e-16 | 76% |
| RefSeq | Arabidopsis thaliana | NP_181578.1 | putative peptide/nitrate transporter [Arabidopsis thaliana] | 2.0e-16 | 76% |
| RefSeq | Populus trichocarpa | XP_002301861.1 | predicted protein [Populus trichocarpa] | 3.0e-18 | 80% |
Full-Lengther Next Prediction |
|---|
Fln status: N-terminus
Fln database: coniferopsida.fasta
Fln subject: A9NVR2
Fln msg: Distance to subject end: 521 aas, your sequence is shorter than subject: 60 - 594
Fln protein:
M
Protein Length:
61
Fln nts:
C
Fln Alignment:
GG46A6U02IXPZY___FTMDGSVDLKGRPVLKSKTGRWKACSFVVCYELFERMAFYGI
A9NVR2_______________YTGDGSVDFWGRPSVKENTGNWRACPFILGNECCERLAYYGI

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta