|
||||||
|
UniGene Name: sp_v3.0_unigene72697
Length: 186 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene72697
C |
|
Ace file of the UniGene sp_v3.0_unigene72697
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Eukaryotic translation initiation factor 2c, putative n=1 Tax=Ricinus communis RepID=B9SJV6_RICCO | - | - | 2.0e-18 | 75% |
| FL-Next | sp=Protein argonaute 1; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 73% |
| Sma3 | Argonaute family member | - | - | 1.399e-07 | - |
| Source | Gene names |
|---|---|
| Sma3 | AGO1; AGO2; AGO906; AGO915; At1g48410; GSVIVT00000886001; GSVIVT00016822001; GSVIVT00020067001; OJ1149_C12.13; OJ1493_H11.13; OSJNBa0005N02.3; OSJNBa0069C14.10-1; Os02g0672200; Os02g0831600; Os04g0566500; Os06g0729300; OsAGO1; OsI_08429; OsI_09567; OsI_17 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
| Sma3 | endoribonuclease activity | GO:0004521 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | siRNA binding | GO:0035197 | Molecular Function | 0.0 | - |
| Sma3 | miRNA binding | GO:0035198 | Molecular Function | 0.0 | - |
| Sma3 | virus induced gene silencing | GO:0009616 | Biological Process | 0.0 | - |
| Sma3 | response to auxin stimulus | GO:0009733 | Biological Process | 0.0 | - |
| Sma3 | embryo development ending in seed dormancy | GO:0009793 | Biological Process | 0.0 | - |
| Sma3 | auxin metabolic process | GO:0009850 | Biological Process | 0.0 | - |
| Sma3 | leaf morphogenesis | GO:0009965 | Biological Process | 0.0 | - |
| Sma3 | response to far red light | GO:0010218 | Biological Process | 0.0 | - |
| Sma3 | RNA interference | GO:0016246 | Biological Process | 0.0 | - |
| Sma3 | stem cell maintenance | GO:0019827 | Biological Process | 0.0 | - |
| Sma3 | gene silencing by miRNA | GO:0035195 | Biological Process | 0.0 | - |
| Sma3 | leaf development | GO:0048366 | Biological Process | 0.0 | - |
| Sma3 | adventitious root development | GO:0048830 | Biological Process | 0.0 | - |
| Sma3 | stem cell development | GO:0048864 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Argonaute/Dicer protein, PAZ | IPR003100 | - | 0.0 | - |
| Sma3 | Stem cell self-renewal protein Piwi | IPR003165 | - | 0.0 | - |
| Sma3 | Domain of unknown function DUF1785 | IPR014811 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G48410.2 | - | 2.0e-22 | 73% |
| RefSeq | Arabidopsis thaliana | NP_175274.1 | protein argonaute [Arabidopsis thaliana] | 3.0e-22 | 73% |
| RefSeq | Populus trichocarpa | XP_002318338.1 | argonaute protein group [Populus trichocarpa] | 1.0e-23 | 75% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: O04379
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 817 aas, your sequence is shorter than subject: 61 - 1048
Fln protein:
S
Protein Length:
62
Fln nts:
C
Fln Alignment:
GG46A6U02G74MB___FPRRPGKGQTGIKCLVKANHFITELPEKDLHQYDVTIKPEVTSRGLNRSVIRQ
O04379_______________FPMRPGKGQSGKRCIVKANHFFAELPDKDLHHYDVTITPEVTSRGVNRAVMKQ
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
