|
||||||
|
UniGene Name: sp_v3.0_unigene72641
Length: 150 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene72641
C |
|
Ace file of the UniGene sp_v3.0_unigene72641
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | cleavage/polyadenylation specificity factor [Arabidopsis thaliana] dbj|BAC42701.1| unknown protein [Arabidopsis thaliana] gb|AAO63939.1| unknown protein [Arabidopsis thaliana] dbj|BAF00402.1| hypothetical protein [Arabidopsis thaliana] gb|AEE85076.1| clea | - | - | 1.0e-10 | 71% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 97% |
| Source | Gene names |
|---|---|
| Sma3 | At4g25550; At4g25550/M7J2_80; GSVIVT00010497001; GSVIVT00026791001; H0124B04.17; OSJNBa0032F06.22; Os04g0683100; OsI_17973; OsJ_16671; PHYPADRAFT_121377; POPTRDRAFT_734153; RCOM_1496400; VITISV_016616; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | solute:hydrogen antiporter activity | GO:0015299 | Molecular Function | 0.0 | - |
| Sma3 | hydrolase activity | GO:0016787 | Molecular Function | 0.0 | - |
| Sma3 | mismatched DNA binding | GO:0030983 | Molecular Function | 0.0 | - |
| Sma3 | mismatch repair | GO:0006298 | Biological Process | 0.0 | - |
| Sma3 | potassium ion transport | GO:0006813 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | NUDIX hydrolase domain | IPR000086 | - | 0.0 | - |
| Sma3 | DNA mismatch repair protein MutS, C-terminal | IPR000432 | - | 0.0 | - |
| Sma3 | Regulator of K+ conductance, N-terminal | IPR003148 | - | 0.0 | - |
| Sma3 | K+/H+ exchanger | IPR004771 | - | 0.0 | - |
| Sma3 | Cation/H+ exchanger | IPR006153 | - | 0.0 | - |
| Sma3 | DNA mismatch repair protein MutS-like, N-terminal | IPR007695 | - | 0.0 | - |
| Sma3 | DNA mismatch repair protein MutS, core | IPR007696 | - | 0.0 | - |
| Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
| Sma3 | DNA mismatch repair protein MutS, N-terminal | IPR016151 | - | 0.0 | - |
| Sma3 | Cleavage/polyadenylation specificity factor, 25kDa subunit | IPR016706 | - | 0.0 | - |
| Sma3 | Chromogranin, conserved site | IPR018054 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G25550.1 | Cleavage/polyadenylation specificity factor, 25kDa subunit chr4:13048519-13050873 FORWARD LENGTH=200 | 7.0e-16 | 71% |
| RefSeq | Arabidopsis thaliana | NP_194285.2 | cleavage/polyadenylation specificity factor [Arabidopsis thaliana] | 9.0e-16 | 71% |
| RefSeq | Populus trichocarpa | XP_002321911.1 | predicted protein [Populus trichocarpa] | 6.0e-16 | 67% |
| Full-Lengther Next Prediction |
|---|
Fln status: Putative C-terminus
Fln database: coniferopsida.fasta
Fln subject: C0PR58
Fln msg: Unexpected stop codon in the beginning of your sequence, STOP codon was not found. Distance to subject end: 7 aas, your sequence is shorter than subject: 49 - 198
Fln protein:
S
Protein Length:
50
Fln nts:
C
Fln Alignment:
GG46A6U02GPYEK___ISENQCFEIPKNLKILAVPLFELFDNVEKYGPEISSIPQQLS
C0PR58_______________LSENQCFEIPKNLKILAVPLFELFDNVEKYGPEISSIPQQLS
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
