|
||||||
|
UniGene Name: sp_v3.0_unigene72635
Length: 167 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene72635
C |
|
Ace file of the UniGene sp_v3.0_unigene72635
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | putative uridine kinase [Arabidopsis thaliana] | - | - | 5.0e-19 | 82% |
| FL-Next | sp=Uridine kinase-like protein 1, chloroplastic; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 82% |
| Sma3 | Uridine kinase | - | - | 0.0 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Uracil phosphoribosyltransferase. | EC:2.4.2.9 | - | 6.1e-13 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Pyrimidine metabolism | 00240 | 6.1e-13 | % | |
| Sma3 | Metabolic pathways | 01100 | 6.1e-13 | % | |
| Sma3 | Uridine kinase. | EC:2.7.1.48 | - | 0.0 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Pyrimidine metabolism | 00240 | 0.0 | % | |
| Sma3 | Drug metabolism - other enzymes | 00983 | 0.0 | % | |
| Sma3 | Metabolic pathways | 01100 | 0.0 | % |
| Source | Gene names |
|---|---|
| Sma3 | AT1G55810; At1g55810; At3g27190; At3g27440; At4g26510; At5g40870; CHLREDRAFT_170716; CHLREDRAFT_77471; GSVIVT00003320001; GSVIVT00017920001; GSVIVT00017923001; GSVIVT00020531001; GSVIVT00020636001; LOC_Os11g16370; MICPUCDRAFT_49146; MICPUN_82049; OJ1770_H |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | uracil phosphoribosyltransferase activity | GO:0004845 | Molecular Function | 0.0 | - |
| Sma3 | uridine kinase activity | GO:0004849 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | kinase activity | GO:0016301 | Molecular Function | 0.0 | - |
| Sma3 | transferase activity, transferring glycosyl groups | GO:0016757 | Molecular Function | 0.0 | - |
| Sma3 | phosphotransferase activity, alcohol group as acceptor | GO:0016773 | Molecular Function | 0.0 | - |
| Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
| Sma3 | nucleoside metabolic process | GO:0009116 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Uridine kinase | IPR000764 | - | 0.0 | - |
| Sma3 | Phosphoribosyltransferase | IPR000836 | - | 0.0 | - |
| Sma3 | Phosphoribulokinase/uridine kinase | IPR006083 | - | 0.0 | - |
| Sma3 | Protein of unknown function DUF1296 | IPR009719 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G40870.1 | ATUK/UPRT1, UKL1, UK/UPRT1 uridine kinase/uracil phosphoribosyltransferase 1 chr5:16375021-16378384 FORWARD LENGTH=486 | 5.0e-25 | 82% |
| RefSeq | Arabidopsis thaliana | NP_198903.1 | putative uracil phosphoribosyltransferase [Arabidopsis thaliana] | 6.0e-25 | 82% |
| RefSeq | Populus trichocarpa | XP_002298617.1 | predicted protein [Populus trichocarpa] | 4.0e-25 | 95% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9FKS0
Fln msg: Distance to subject end: 136 aas, your sequence is shorter than subject: 55 - 486
Fln protein:
R
Protein Length:
56
Fln nts:
C
Fln Alignment:
GG46A6U02JH4O3___RDLGCHSF--YSDRLIRLVVENGLGHLPFTEKQVTTPTGSVYTGVDFCKKLCGVSI
Q9FKS0_______________KDISKHDFVFYSDRLIRLVVEHGLGHLPFTEKQVVTPTGAVYTGVDFCKKLCGVSI
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
