UniGene Name: sp_v3.0_unigene72613
Length: 191 nt
![]() |
---|
>sp_v3.0_unigene72613
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Putative calcium dependent protein kinase (Fragment) n=4 Tax=Silene RepID=B8Q983_9CARY | - | - | 1.0e-21 | 90% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 66% |
Sma3 | CDPK-related protein kinase | - | - | 3.649e-24 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Calcium/calmodulin-dependent protein kinase. | EC:2.7.11.17 | - | 2.154e-14 | - |
Source | Gene names |
---|---|
Sma3 | AT5G66210; At1g49580; At2g17890; At2g41140; At3g19100; At3g49370; At3g50530; At3g56760; At4g36070; At5g24430; At5g66210; CAMK1; CDPK1; CDPK5; CPK16; CPK18; CPK28; CPK5; CPK6; CRK; CRK1; CRK2; CRK3; CRK4; CRK5; CRK7; CRK8; F14J22.18; F2K15.230; GSVIVT00009 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | calmodulin-dependent protein kinase activity | GO:0004683 | Molecular Function | 0.0 | - |
Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | calmodulin binding | GO:0005516 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Calcium-binding EF-hand | IPR002048 | - | 0.0 | - |
Sma3 | Serine/threonine- / dual-specificity protein kinase, catalytic domain | IPR002290 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | EF-hand-like domain | IPR011992 | - | 0.0 | - |
Sma3 | Calmodulin-binding domain, plant | IPR012417 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - | |
Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
Sma3 | EF-hand | IPR018248 | - | 0.0 | - |
Sma3 | EF-HAND 2 | IPR018249 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G17890.1 | CPK16 calcium-dependent protein kinase 16 chr2:7769885-7772627 REVERSE LENGTH=571 | 1.0e-26 | 87% |
RefSeq | Arabidopsis thaliana | NP_179379.1 | calcium-dependent protein kinase 16 [Arabidopsis thaliana] | 2.0e-26 | 87% |
RefSeq | Populus trichocarpa | XP_002304327.1 | calcium dependent protein kinase 16 [Populus trichocarpa] | 1.0e-27 | 89% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NWM8
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 348 aas, your sequence is shorter than subject: 63 - 589
Fln protein:
S
Protein Length:
64
Fln nts:
C
Fln Alignment:
GG46A6U02IO4YD___NVKREVRILQALTGHENVVQFYNAFEDDDFVYIVMELCEGGELLDRILAK
A9NWM8_______________DVRREVKILKALSGHHNLVKFHDACEDANNVYIIMELCEGGELLDRILSR
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain