UniGene Name: sp_v3.0_unigene72591
Length: 210 nt
![]() |
---|
>sp_v3.0_unigene72591
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Cationic peroxidase 1, putative n=1 Tax=Ricinus communis RepID=B9SWU3_RICCO | - | - | 5.0e-16 | 65% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 57% |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Peroxidase. | EC:1.11.1.7 | - | 8.648e-16 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Phenylalanine metabolism | 00360 | 8.648e-16 | % | |
Sma3 | Methane metabolism | 00680 | 8.648e-16 | % | |
Sma3 | Phenylpropanoid biosynthesis | 00940 | 8.648e-16 | % | |
Sma3 | Biosynthesis of phenylpropanoids | 01061 | 8.648e-16 | % | |
Sma3 | Metabolic pathways | 01100 | 8.648e-16 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 8.648e-16 | % |
Source | Gene names |
---|---|
Sma3 | At1g05260; At3g21770; GSVIVT00022533001; GSVIVT00022535001; GSVIVT00022537001; GSVIVT00037159001; MSD21.10; MSD21.8; OSJNBa0034O12.19; OSJNBb0099P06.2; Os05g0162000; OsI_18569; OsJ_17220; P3; P30; PER3; PER30; PHYPADRAFT_186076; POPTRDRAFT_569675; POPTRDR |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | extracellular region | GO:0005576 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | peroxidase activity | GO:0004601 | Molecular Function | 0.0 | - |
Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
Sma3 | response to desiccation | GO:0009269 | Biological Process | 0.0 | - |
Sma3 | response to cold | GO:0009409 | Biological Process | 0.0 | - |
Sma3 | hyperosmotic salinity response | GO:0042538 | Biological Process | 0.0 | - |
Sma3 | hydrogen peroxide catabolic process | GO:0042744 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Plant peroxidase | IPR000823 | - | 0.0 | - |
Sma3 | Haem peroxidase, plant/fungal/bacterial | IPR002016 | - | 0.0 | - |
Sma3 | Peroxidases heam-ligand binding site | IPR019793 | - | 0.0 | - |
Sma3 | Peroxidase, active site | IPR019794 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G21770.1 | Peroxidase superfamily protein chr3:7673345-7674661 FORWARD LENGTH=329 | 2.0e-17 | 60% |
RefSeq | Arabidopsis thaliana | NP_188814.1 | peroxidase 30 [Arabidopsis thaliana] | 3.0e-17 | 60% |
RefSeq | Populus trichocarpa | XP_002321949.1 | predicted protein [Populus trichocarpa] | 2.0e-18 | 63% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9P1P4
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 78 aas, your sequence is shorter than subject: 69 - 324
Fln protein:
S
Protein Length:
70
Fln nts:
C
Fln Alignment:
GG46A6U02G2A0T___MVLLSGAHSIGVSHCTSFVTRLYNFSTTIPTDPSLDPKYAAFLKEKCPQGSSNNITTVFMD
A9P1P4_______________LVVLSGGHTIGMSHCNSFSSRLYNFTGKGDMDPSLDKSYAAHLKIKCKPG--DNKTIVEMD
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain