|
||||||
|
UniGene Name: sp_v3.0_unigene72537
Length: 167 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene72537
C |
|
Ace file of the UniGene sp_v3.0_unigene72537
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Retrotransposon protein, putative, Ty3-gypsy subclass n=1 Tax=Oryza sativa Japonica Group RepID=Q2QZE5_ORYSJ | - | - | 6.0e-11 | 71% |
| FL-Next | tr=Retrotransposon protein, putative, Ty3-gypsy subclass; Oryza sativa subsp. japonica (Rice). | - | - | 0.0 | 71% |
| Sma3 | Retrotransposon protein, putative, Ty3-gypsy subclass | - | - | 0.0 | - |
| Source | Gene names |
|---|---|
| Sma3 | B1168G10.5; H0124E07.7; H0207B04.5; H0211F06-OSIGBa0153M17.10; H0306F03.2; H0409D10.7; H0425E08.11; H0502B11.9; H0512B01.1; H0522A01.6; H0613A10.2; H0616A11.3; H0622G10.3; H0807C06-H0308C08.6; H0820C10.2; LOC_Os03g04860; LOC_Os03g23110; LOC_Os03g23780; LO |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | chromatin | GO:0000785 | Cellular Component | 0.0 | - |
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | chromatin binding | GO:0003682 | Molecular Function | 0.0 | - |
| Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
| Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
| Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
| Sma3 | ribonuclease H activity | GO:0004523 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | ATPase activity | GO:0016887 | Molecular Function | 0.0 | - |
| Sma3 | protein dimerization activity | GO:0046983 | Molecular Function | 0.0 | - |
| Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
| Sma3 | chromatin assembly or disassembly | GO:0006333 | Biological Process | 0.0 | - |
| Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
| Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
| Sma3 | Chromo domain/shadow | IPR000953 | - | 0.0 | - |
| Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
| Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
| Sma3 | Peptidase aspartic, active site | IPR001969 | - | 0.0 | - |
| Sma3 | Peptidase A2A, retrovirus, catalytic | IPR001995 | - | 0.0 | - |
| Sma3 | Ribonuclease H domain | IPR002156 | - | 0.0 | - |
| Sma3 | ABC transporter-like | IPR003439 | - | 0.0 | - |
| Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
| Sma3 | Retrotransposon gag protein | IPR005162 | - | 0.0 | - |
| Sma3 | Phosphopantetheine attachment site | IPR006162 | - | 0.0 | - |
| Sma3 | Domain of unknown function DUF659 | IPR007021 | - | 0.0 | - |
| Sma3 | Domain of unknown function DUF834 | IPR008552 | - | 0.0 | - |
| Sma3 | HAT dimerisation | IPR008906 | - | 0.0 | - |
| Sma3 | Retroviral aspartyl protease | IPR013242 | - | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: tr_plants
Fln subject: Q2QZE5
Fln msg: Distance to subject end: 571 aas, your sequence is shorter than subject: 55 - 785
Fln protein:
V
Protein Length:
56
Fln nts:
C
Fln Alignment:
GG46A6U02I7XTM___VLM**GKVVCYESRKLNEHEVNFFTHDLELAAIIHALKMWRHYLL
Q2QZE5_______________VLMQDGKVVAYASRQLRPHEVNYPTHDLELAAVVHALKIWRHYLI
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
