UniGene Name: sp_v3.0_unigene72506
Length: 159 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene72506
C |
Ace file of the UniGene sp_v3.0_unigene72506
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Auxin-induced protein 5 n=1 Tax=Pinus taeda RepID=Q7XYT2_PINTA | - | - | 2.0e-19 | 97% |
| FL-Next | tr=Auxin-induced protein 5; Pinus taeda (Loblolly pine). | - | - | 0.0 | 97% |
| Sma3 | Aux/IAA protein | - | - | 6.718e-30 | - |
| Source | Gene names |
|---|---|
| Sma3 | ARG12; ARG13; ARG14; ARG3; ARG4; AUX2-11; AUX2-27; AUX22; AUX22A; AUX22B; AUX22C; AUX22D; AUX22E; AUX28; AXR2; AXR3; At1g04240; At1g04250; At1g04550; At1g15580; At1g80390; At2g22670; At2g33310; At3g04730; At3g15540; At3g23030; At3g23050; At4g14550; At4g14 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | transcription repressor activity | GO:0016564 | Molecular Function | 0.0 | - |
| Sma3 | identical protein binding | GO:0042802 | Molecular Function | 0.0 | - |
| Sma3 | protein dimerization activity | GO:0046983 | Molecular Function | 0.0 | - |
| Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
| Sma3 | response to water deprivation | GO:0009414 | Biological Process | 0.0 | - |
| Sma3 | response to wounding | GO:0009611 | Biological Process | 0.0 | - |
| Sma3 | gravitropism | GO:0009630 | Biological Process | 0.0 | - |
| Sma3 | auxin mediated signaling pathway | GO:0009734 | Biological Process | 0.0 | - |
| Sma3 | response to jasmonic acid stimulus | GO:0009753 | Biological Process | 0.0 | - |
| Sma3 | embryonic pattern specification | GO:0009880 | Biological Process | 0.0 | - |
| Sma3 | xylem and phloem pattern formation | GO:0010051 | Biological Process | 0.0 | - |
| Sma3 | lateral root morphogenesis | GO:0010102 | Biological Process | 0.0 | - |
| Sma3 | GO:0045449 | Biological Process | 0.0 | - | |
| Sma3 | root development | GO:0048364 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Nitrogen regulatory protein P-II, urydylation site | IPR002332 | - | 0.0 | - |
| Sma3 | AUX/IAA protein | IPR003311 | - | 0.0 | - |
| Sma3 | TonB box, conserved site | IPR010916 | - | 0.0 | - |
| Sma3 | Aux/IAA-ARF-dimerisation | IPR011525 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G04730.1 | IAA16 indoleacetic acid-induced protein 16 chr3:1288993-1290415 REVERSE LENGTH=236 | 1.0e-23 | 84% |
| RefSeq | Arabidopsis thaliana | NP_187124.1 | auxin-responsive protein IAA16 [Arabidopsis thaliana] | 2.0e-23 | 84% |
| RefSeq | Populus trichocarpa | XP_002319075.1 | predicted protein [Populus trichocarpa] | 2.0e-23 | 84% |
Full-Lengther Next Prediction |
|---|
Fln status: Putative C-terminus
Fln database: coniferopsida.fasta
Fln subject: Q7XYT2
Fln msg: Unexpected stop codon in the beginning of your sequence, STOP codon was not found. Distance to subject end: 7 aas, your sequence is shorter than subject: 52 - 252
Fln protein:
S
Protein Length:
53
Fln nts:
C
Fln Alignment:
GG46A6U02FVVZB___IPTYEDKDGDWMLVGDVPWQMFVDSCQRMRIMKASEAIGLAPRTM
Q7XYT2_______________VPTYEDKDGDWMLVGDVPWQMFVDSCQRMRIMKASEAIGLAPRTM

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta