UniGene Name: sp_v3.0_unigene72474
Length: 157 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene72474
C |
Ace file of the UniGene sp_v3.0_unigene72474
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Putative phospholipase C n=1 Tax=Solanum lycopersicum RepID=Q5GA62_SOLLC | - | - | 2.0e-10 | 75% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 77% |
| Sma3 | Phospholipase C | - | - | 1.321e-20 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Phosphoinositide phospholipase C. | EC:3.1.4.11 | - | 2.679e-20 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Inositol phosphate metabolism | 00562 | 2.679e-20 | % | |
| Sma3 | Metabolic pathways | 01100 | 2.679e-20 | % | |
| Sma3 | Phosphatidylinositol signaling system | 04070 | 2.679e-20 | % |
| Source | Gene names |
|---|---|
| Sma3 | 56B23-g8; AT3G08510; At2g40116; At3g08510; At3g55940; F27K19.120; GSVIVT00021509001; GSVIVT00024093001; GSVIVT00029292001; GSVIVT00029293001; LOC_Os12g37560; Os12g0562400; OsI_38731; OsJ_36515; PLC; PLC1; PLC10; PLC2; PLC3; PLC6; PLC7; PLC8; POPTRDRAFT_56 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | phosphatidylinositol phospholipase C activity | GO:0004435 | Molecular Function | 0.0 | - |
| Sma3 | signal transducer activity | GO:0004871 | Molecular Function | 0.0 | - |
| Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
| Sma3 | phosphatidylcholine phospholipase C activity | GO:0034480 | Molecular Function | 0.0 | - |
| Sma3 | lipid metabolic process | GO:0006629 | Biological Process | 0.0 | - |
| Sma3 | GO:0007242 | Biological Process | 0.0 | - | |
| Sma3 | lipid catabolic process | GO:0016042 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | C2 calcium-dependent membrane targeting | IPR000008 | - | 0.0 | - |
| Sma3 | Phospholipase C, phosphatidylinositol-specific , X domain | IPR000909 | - | 0.0 | - |
| Sma3 | Phosphoinositide phospholipase C | IPR001192 | - | 0.0 | - |
| Sma3 | Phospholipase C, phosphatidylinositol-specific, Y domain | IPR001711 | - | 0.0 | - |
| Sma3 | EF-hand-like domain | IPR011992 | - | 0.0 | - |
| Sma3 | Phospholipase C, phosphoinositol-specific, EF-hand-like | IPR015359 | - | 0.0 | - |
| Sma3 | PLC-like phosphodiesterase, TIM beta/alpha-barrel domain | IPR017946 | - | 0.0 | - |
| Sma3 | C2 membrane targeting protein | IPR018029 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G40116.1 | Phosphoinositide-specific phospholipase C family protein chr2:16751782-16754311 FORWARD LENGTH=613 | 1.0e-14 | 75% |
| RefSeq | Arabidopsis thaliana | NP_850327.2 | phosphoinositide phospholipase C 6 [Arabidopsis thaliana] | 2.0e-14 | 75% |
| RefSeq | Populus trichocarpa | XP_002316213.1 | predicted protein [Populus trichocarpa] | 9.0e-14 | 72% |
Full-Lengther Next Prediction |
|---|
Fln status: Putative C-terminus
Fln database: coniferopsida.fasta
Fln subject: B8LLW1
Fln msg: Unexpected stop codon in the beginning of your sequence, STOP codon was not found. Distance to subject end: 15 aas, your sequence is shorter than subject: 51 - 597
Fln protein:
S
Protein Length:
52
Fln nts:
C
Fln Alignment:
GG46A6U02HF990___LSLKVGEYDMSEKDDFGGQTCLPVTELKSGIRSTPLFNKK
B8LLW1_______________LRVEVHEYDMSEKDDFGGQTCVPVAELKSGIRTIPLCNKK

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta