|
||||||
|
UniGene Name: sp_v3.0_unigene72462
Length: 118 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene72462
C |
|
Ace file of the UniGene sp_v3.0_unigene72462
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | casein kinase [Beta vulgaris] | - | - | 2.0e-11 | 91% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 91% |
| Sma3 | Putative casein kinase I | - | - | 5.402e-19 | - |
| Source | Gene names |
|---|---|
| Sma3 | ADK1; AT4g08800; AT4g14340; AT4g28540; AT4g28860; AT4g28880; At1g03930; At1g04440; At1g72710; At1g72710/F28P22.10; At2g19470; At3g23340; At4g08800; At4g14340; At4g26100; At4g28540; At4g28860; At4g28880; At4g28880/F16A16_10; At5g43320; At5g44100; At5g57015 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | plasmodesma | GO:0009506 | Cellular Component | 0.0 | - |
| Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | kinase activity | GO:0016301 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | Alpha-isopropylmalate/homocitrate synthase, conserved site | IPR002034 | - | 0.0 | - |
| Sma3 | Domain of unknown function DUF71, ATP-binding domain | IPR002761 | - | 0.0 | - |
| Sma3 | YjgF/Yer057p/UK114 family | IPR006175 | - | 0.0 | - |
| Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
| Sma3 | Endoribonuclease L-PSP/chorismate mutase-like | IPR013813 | - | 0.0 | - |
| Sma3 | Rossmann-like alpha/beta/alpha sandwich fold | IPR014729 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | IPR017442 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G08800.1 | Protein kinase superfamily protein chr4:5614134-5615919 FORWARD LENGTH=285 | 3.0e-16 | 85% |
| RefSeq | Arabidopsis thaliana | NP_192620.1 | protein kinase family protein [Arabidopsis thaliana] | 4.0e-16 | 85% |
| RefSeq | Populus trichocarpa | XP_002306864.1 | predicted protein [Populus trichocarpa] | 2.0e-16 | 88% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LR36
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 265 aas, your sequence is shorter than subject: 38 - 479
Fln protein:
S
Protein Length:
39
Fln nts:
C
Fln Alignment:
GG46A6U02JALVN___WLSLNTHLGIEQSRRDDLESLGYVLMYFLRGSLPW
B8LR36_______________YASINTHLGIEQSRRDDLESLGYVLMYFLRGSLPW
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
