|
||||||
|
UniGene Name: sp_v3.0_unigene72344
Length: 193 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene72344
C |
|
Ace file of the UniGene sp_v3.0_unigene72344
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Cu2+-exporting ATPase [Arabidopsis thaliana] sp|Q9SH30.2|AHM7_ARATH RecName: Full=Putative copper-transporting ATPase 3 gb|ACF95837.1| heavy metal P-type ATPase [Arabidopsis thaliana] gb|ACF95838.1| heavy metal P-type ATPase [Arabidopsis thaliana] gb|ACF9 | - | - | 1.0e-14 | 66% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 63% |
| Sma3 | Heavy metal ATPase | - | - | 4.034e-18 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Copper-exporting ATPase. | EC:3.6.3.4 | - | 9.757e-21 | - |
| Source | Gene names |
|---|---|
| Sma3 | ATPase2-1B; At1g63440; At5g44790; F2K11.18; GSVIVT00000399001; GSVIVT00000403001; GSVIVT00000405001; GSVIVT00024633001; GSVIVT00030125001; HMA5; K23L20.14; MICPUCDRAFT_56356; MICPUCDRAFT_58940; MICPUN_58693; OJ1225_F07.30; OJ1524_D08.15; Os02g0172600; Os0 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Golgi apparatus | GO:0005794 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | magnesium ion binding | GO:0000287 | Molecular Function | 0.0 | - |
| Sma3 | copper-exporting ATPase activity | GO:0004008 | Molecular Function | 0.0 | - |
| Sma3 | copper ion binding | GO:0005507 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism | GO:0015662 | Molecular Function | 0.0 | - |
| Sma3 | metal ion binding | GO:0046872 | Molecular Function | 0.0 | - |
| Sma3 | ATP biosynthetic process | GO:0006754 | Biological Process | 0.0 | - |
| Sma3 | copper ion transport | GO:0006825 | Biological Process | 0.0 | - |
| Sma3 | ethylene mediated signaling pathway | GO:0009873 | Biological Process | 0.0 | - |
| Sma3 | regulation of stomatal movement | GO:0010119 | Biological Process | 0.0 | - |
| Sma3 | detoxification of copper ion | GO:0010273 | Biological Process | 0.0 | - |
| Sma3 | metal ion transport | GO:0030001 | Biological Process | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G63440.1 | HMA5 heavy metal atpase 5 chr1:23527655-23531109 FORWARD LENGTH=995 | 3.0e-19 | 86% |
| RefSeq | Arabidopsis thaliana | NP_176533.1 | Cu2+-exporting ATPase [Arabidopsis thaliana] | 4.0e-19 | 86% |
| RefSeq | Populus trichocarpa | XP_002303580.1 | heavy metal ATPase [Populus trichocarpa] | 2.0e-17 | 79% |
| Full-Lengther Next Prediction |
|---|
Fln status: Putative C-terminus
Fln database: coniferopsida.fasta
Fln subject: B8LQ20
Fln msg: Unexpected stop codon in the beginning of your sequence, STOP codon was not found. Distance to subject end: 11 aas, your sequence is shorter than subject: 63 - 998
Fln protein:
S
Protein Length:
64
Fln nts:
C
Fln Alignment:
GG46A6U02FFK5M___LSLNYVWALGYNVMGIPIAAGLLFPFIRFRLPPWIAGAAMA
B8LQ20_______________IRLNYVFAMGYNIFAIPLAAGLFFPFLKISLPPWVSGAAMA
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
