|
||||||
|
UniGene Name: sp_v3.0_unigene72322
Length: 224 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene72322
C |
|
Ace file of the UniGene sp_v3.0_unigene72322
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Ribose-phosphate pyrophosphokinase n=3 Tax=Physcomitrella patens subsp. patens RepID=A9T1V2_PHYPA | - | - | 3.0e-24 | 89% |
| FL-Next | sp=Ribose-phosphate pyrophosphokinase; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 77% |
| Sma3 | Ribose-phosphate pyrophosphokinase | - | - | 4.2039e-45 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ribose-phosphate diphosphokinase. | EC:2.7.6.1 | - | 0.0 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Pentose phosphate pathway | 00030 | 0.0 | % | |
| Sma3 | Purine metabolism | 00230 | 0.0 | % | |
| Sma3 | Biosynthesis of alkaloids derived from histidine and purine | 01065 | 0.0 | % | |
| Sma3 | Biosynthesis of plant hormones | 01070 | 0.0 | % | |
| Sma3 | Metabolic pathways | 01100 | 0.0 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 0.0 | % |
| Source | Gene names |
|---|---|
| Sma3 | At1g32380; At2g35390; At2g44530; CHLREDRAFT_137493; F16B22.2; F5D14.15; GSVIVT00015830001; GSVIVT00018977001; LOC_Os02g03540; LOC_Os06g41360; MICPUCDRAFT_13173; MICPUN_83316; Os02g0127700; Os06g0617800; OsI_05689; OsI_09602; OsI_23708; OsJ_05220; OsJ_0904 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | magnesium ion binding | GO:0000287 | Molecular Function | 0.0 | - |
| Sma3 | ribose phosphate diphosphokinase activity | GO:0004749 | Molecular Function | 0.0 | - |
| Sma3 | kinase activity | GO:0016301 | Molecular Function | 0.0 | - |
| Sma3 | nucleoside metabolic process | GO:0009116 | Biological Process | 0.0 | - |
| Sma3 | ribonucleoside monophosphate biosynthetic process | GO:0009156 | Biological Process | 0.0 | - |
| Sma3 | nucleotide biosynthetic process | GO:0009165 | Biological Process | 0.0 | - |
| Sma3 | cellular biosynthetic process | GO:0044249 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Phosphoribosyltransferase | IPR000836 | - | 0.0 | - |
| Sma3 | Phosphoribosyl pyrophosphate synthetase, conserved site | IPR000842 | - | 0.0 | - |
| Sma3 | Ribose-phosphate diphosphokinase | IPR005946 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G44530.1 | Phosphoribosyltransferase family protein chr2:18383732-18385974 FORWARD LENGTH=394 | 5.0e-27 | 84% |
| RefSeq | Arabidopsis thaliana | NP_001078057.1 | ribose-phosphate pyrophosphokinase 5 [Arabidopsis thaliana] | 6.0e-27 | 84% |
| RefSeq | Populus trichocarpa | XP_002320580.1 | predicted protein [Populus trichocarpa] | 1.0e-27 | 88% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: C0PTR8
Fln msg: Distance to subject end: 61 aas, your sequence is shorter than subject: 74 - 247
Fln protein:
R
Protein Length:
75
Fln nts:
C
Fln Alignment:
GG46A6U02FPCOF___SDAPLAIVDKRRQGHNVSEVMNLIGDVKGKVAVMVDDMIDTAGTITNGAALLHVRGCPEKSMHAAH
C0PTR8_______________SDSPLAIVDKRRQGHNTSEVRNLIGDVNGKVAVMVDDMIDTAGTIANGAALLHEKGAREVYACSTH
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
