|
||||||
|
UniGene Name: sp_v3.0_unigene72280
Length: 179 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene72280
C |
|
Ace file of the UniGene sp_v3.0_unigene72280
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | importin alpha 1b [Oryza sativa Japonica Group] | - | - | 2.0e-12 | 83% |
| FL-Next | sp=Importin subunit alpha-1; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 83% |
| Sma3 | Importin alpha-like protein | - | - | 1.033e-14 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT1G09270; At1g02690; At1g09270; At3g06720; At4g02150; B1045F02.27; BIMPa; CHLREDRAFT_139246; F3E22.14; GSVIVT00009657001; GSVIVT00022582001; GSVIVT00022647001; GSVIVT00028070001; GSVIVT00033097001; IPA1; Impa-2; Impa-4; Impa3; KAP1; KAP2; LOC_Os01g14950; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | nuclear pore | GO:0005643 | Cellular Component | 0.0 | - |
| Sma3 | nucleolus | GO:0005730 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | protein transporter activity | GO:0008565 | Molecular Function | 0.0 | - |
| Sma3 | protein dimerization activity | GO:0046983 | Molecular Function | 0.0 | - |
| Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
| Sma3 | protein import into nucleus | GO:0006606 | Biological Process | 0.0 | - |
| Sma3 | defense response | GO:0006952 | Biological Process | 0.0 | - |
| Sma3 | auxin mediated signaling pathway | GO:0009734 | Biological Process | 0.0 | - |
| Sma3 | symbiont intracellular protein transport in host | GO:0030581 | Biological Process | 0.0 | - |
| Sma3 | induction by symbiont in host of tumor, nodule, or growth | GO:0044005 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Armadillo | IPR000225 | - | 0.0 | - |
| Sma3 | Importin-alpha, importin-beta-binding domain | IPR002652 | - | 0.0 | - |
| Sma3 | AUX/IAA protein | IPR003311 | - | 0.0 | - |
| Sma3 | Aux/IAA-ARF-dimerisation | IPR011525 | - | 0.0 | - |
| Sma3 | Armadillo-like helical | IPR011989 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G06720.1 | AT-IMP, ATKAP ALPHA, AIMP ALPHA, IMPA-1, IMPA1 importin alpha isoform 1 chr3:2120559-2123555 FORWARD LENGTH=532 | 2.0e-16 | 81% |
| RefSeq | Arabidopsis thaliana | NP_850524.1 | Importin subunit alpha-1 [Arabidopsis thaliana] | 2.0e-16 | 81% |
| RefSeq | Populus trichocarpa | XP_002328577.1 | predicted protein, partial [Populus trichocarpa] | 7.0e-18 | 83% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q96321
Fln msg: Distance to subject end: 183 aas, your sequence is shorter than subject: 59 - 532
Fln protein:
V
Protein Length:
60
Fln nts:
C
Fln Alignment:
GG46A6U02JTTC3___SVLIPALRTVGNIVTGDDVQTQYIINNQALPCLLALLTQNHKK
Q96321_______________SVLIPALRTVGNIVTGDDIQTQCVINSGALPCLANLLTQNHKK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
