UniGene Name: sp_v3.0_unigene72279
Length: 221 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene72279
C |
Ace file of the UniGene sp_v3.0_unigene72279
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Acetyl-CoA carboxylase, putative n=1 Tax=Ricinus communis RepID=B9SFG9_RICCO | - | - | 4.0e-15 | 72% |
| FL-Next | sp=Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial; Oryza sativa subsp. japonica (Rice). | - | - | 0.0 | 65% |
| Sma3 | Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial | - | - | 7.328e-13 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Methylcrotonoyl-CoA carboxylase. | EC:6.4.1.4 | - | 3.268e-16 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Valine, leucine and isoleucine degradation | 00280 | 3.268e-16 | % | |
| Sma3 | Metabolic pathways | 01100 | 3.268e-16 | % |
| Source | Gene names |
|---|---|
| Sma3 | At1g03090; F10O3.9; F10O3_8; GSVIVT00023766001; LOC_Os12g41250; MCCA; Os12g0605800; OsI_39029; PHYPADRAFT_176782; POPTRDRAFT_559591; RCOM_0646250; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | mitochondrial matrix | GO:0005759 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | cytosolic ribosome | GO:0022626 | Cellular Component | 0.0 | - |
| Sma3 | methylcrotonoyl-CoA carboxylase activity | GO:0004485 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | biotin binding | GO:0009374 | Molecular Function | 0.0 | - |
| Sma3 | ligase activity | GO:0016874 | Molecular Function | 0.0 | - |
| Sma3 | manganese ion binding | GO:0030145 | Molecular Function | 0.0 | - |
| Sma3 | leucine catabolic process | GO:0006552 | Biological Process | 0.0 | - |
| Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Biotin/lipoyl attachment | IPR000089 | - | 0.0 | - |
| Sma3 | Biotin-binding site | IPR001882 | - | 0.0 | - |
| Sma3 | Carbamoyl-phosphate synthetase, large subunit, ATP-binding | IPR005479 | - | 0.0 | - |
| Sma3 | Carbamoyl-phosphate synthase, large subunit, N-terminal | IPR005481 | - | 0.0 | - |
| Sma3 | Biotin carboxylase, C-terminal | IPR005482 | - | 0.0 | - |
| Sma3 | ATP-grasp fold | IPR011761 | - | 0.0 | - |
| Sma3 | Biotin carboxylation domain | IPR011764 | - | 0.0 | - |
| Sma3 | ATP-grasp fold, subdomain 2 | IPR013816 | - | 0.0 | - |
| Sma3 | IPR013817 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G03090.2 | MCCA methylcrotonyl-CoA carboxylase alpha chain, mitochondrial / 3-methylcrotonyl-CoA carboxylase 1 (MCCA) chr1:739715-743819 FORWARD LENGTH=734 | 6.0e-17 | 65% |
| RefSeq | Arabidopsis thaliana | NP_563674.1 | methylcrotonoyl-CoA carboxylase subunit alpha [Arabidopsis thaliana] | 8.0e-17 | 65% |
| RefSeq | Populus trichocarpa | XP_002307604.1 | predicted protein [Populus trichocarpa] | 1.0e-18 | 70% |
Full-Lengther Next Prediction |
|---|
Fln status: C-terminus
Fln database: sp_plants
Fln subject: Q2QMG2
Fln msg: your sequence is shorter than subject: 70 - 737
Fln protein:
R
Protein Length:
71
Fln nts:
C
Fln Alignment:
GG46A6U02GB565___GSVVAPMAGCVVKVLVEDGAMVKKGQSILVLEAMKMEHVVKAPYEGCVRKLQAVVGQR
Q2QMG2_______________GSVLAPMAGLVVKVLLKDGARVEEGQPVMVMEAMKMEHVVKAPCAGYVEGLKATAGQQ

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta