SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene72268

Length: 311 nt

UniGene Fasta

>sp_v3.0_unigene72268
CGTCGTGACCTTGGCTGTCACTCAATTTTACTCACTGAGAATTTTGACCCACAGATTTCAGATTTTGGACTAGCAAAGTGGCTACCGAAGCCATGGACACACCTGATATTAACAGCTGCTATTGAAGGCACGTTTGGCTATCTTGCCCCAGAGTATGTCATGCATGGGATTGTTGATGAGAAAACAGATGTTTTCGCATTTGGTGTACTTCTGCTGGAGCTCATTACTGGTCGCCTTCCAATTGACTCTTCTCAGCAAAGCTTAGTGATGTGGGCAAAGCCTCTGCTTGAACGTAGAAGCATTCAGAAGCT

Ace file of the UniGene sp_v3.0_unigene72268

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	ATP binding protein, putative n=1 Tax=Ricinus communis RepID=B9SFK8_RICCO	-	-	1.0e-35	70%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	64%
Sma3	ATP binding protein, putative	-	-	1.004e-13	-

Source	ECs	Term	Type	e value	Identity
Sma3	Phosphorylase kinase.	EC:2.7.11.19	-	8.265e-07	-
Sma3		EC:2.7.11.3-	-	2.079e-07	-

Source	Gene names
Sma3	AT3G24550; At1g21590; At1g26150; At1g49270; At1g66460; At1g68690; At1g70450; At1g70460; At2g16750; At2g18470; At2g18890; At3g05140; At5g02800; At5g10520; At5g18910; At5g18910/F17K4_160; At5g35960; At5g37790; At5g57670; At5g63940; At5g65530/K21L13_3; F12B1

Source	GOs	Term	Type	Identity
Sma3	chromatin	GO:0000785	Cellular Component	-
Sma3	nucleus	GO:0005634	Cellular Component	-
Sma3	cytoplasm	GO:0005737	Cellular Component	-
Sma3	peroxisome	GO:0005777	Cellular Component	-
Sma3	cytosol	GO:0005829	Cellular Component	-
Sma3	microtubule	GO:0005874	Cellular Component	-
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	integral to plasma membrane	GO:0005887	Cellular Component	-
Sma3	endomembrane system	GO:0012505	Cellular Component	-
Sma3	protein complex	GO:0043234	Cellular Component	-
Sma3	DNA binding	GO:0003677	Molecular Function	-
Sma3	chromatin binding	GO:0003682	Molecular Function	-
Sma3	protein kinase activity	GO:0004672	Molecular Function	-
Sma3	protein serine/threonine kinase activity	GO:0004674	Molecular Function	-
Sma3	protein tyrosine kinase activity	GO:0004713	Molecular Function	-
Sma3	receptor activity	GO:0004872	Molecular Function	-
Sma3	structural molecule activity	GO:0005198	Molecular Function	-
Sma3	structural constituent of cell wall	GO:0005199	Molecular Function	-
Sma3	protein binding	GO:0005515	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	GTP binding	GO:0005525	Molecular Function	-
Sma3	methyltransferase activity	GO:0008168	Molecular Function	-
Sma3	DNA methylation	GO:0006306	Biological Process	-
Sma3	chromatin assembly or disassembly	GO:0006333	Biological Process	-
Sma3	protein phosphorylation	GO:0006468	Biological Process	-
Sma3	response to stress	GO:0006950	Biological Process	-
Sma3	microtubule-based movement	GO:0007018	Biological Process	-
Sma3	defense response, incompatible interaction	GO:0009814	Biological Process	-
Sma3	protein polymerization	GO:0051258	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	IQ motif, EF-hand binding site	IPR000048	-	-
Sma3	Peptidase, cysteine peptidase active site	IPR000169	-	-
Sma3	Tubulin	IPR000217	-	-
Sma3	Protein kinase, catalytic domain	IPR000719	-	-
Sma3	Chromo domain/shadow	IPR000953	-	-
Sma3	Bromo adjacent homology (BAH) domain	IPR001025	-	-
Sma3	Serine-threonine/tyrosine-protein kinase catalytic domain	IPR001245	-	-
Sma3	C-5 cytosine methyltransferase	IPR001525	-	-
Sma3	Nucleoside diphosphate kinase	IPR001564	-	-
Sma3	Myosin head, motor domain	IPR001609	-	-
Sma3	WD40 repeat	IPR001680	-	-
Sma3	Serine/threonine- / dual-specificity protein kinase, catalytic domain	IPR002290	-	-
Sma3	Beta tubulin	IPR002453	-	-
Sma3	Dilute	IPR002710	-	-
Sma3	Tubulin/FtsZ, GTPase domain	IPR003008	-	-
Sma3	Pistil-specific extensin-like protein	IPR003882	-	-
Sma3	Myosin, N-terminal, SH3-like	IPR004009	-	-
Sma3	UspA	IPR006016	-	-
Sma3	Tyrosine-protein kinase, active site	IPR008266	-	-
Sma3	Serine/threonine-protein kinase, active site	IPR008271	-	-
Sma3	EGF-like region, conserved site	IPR013032	-	-
Sma3	Rossmann-like alpha/beta/alpha sandwich fold	IPR014729	-	-
Sma3	SKG6/AXL2 alpha-helix transmembrane domain	IPR014805	-	-
Sma3	NAD(P)-binding domain	IPR016040	-	-
Sma3	Protein kinase, ATP binding site	IPR017441	-	-
Sma3		IPR017442	-	-
Sma3	Homeobox, conserved site	IPR017970	-	-
Sma3	Peptidase S1/S6, chymotrypsin/Hap, active site	IPR018114	-	-
Sma3	DNA methylase, C-5 cytosine-specific, active site	IPR018117	-	-
Sma3	Ribosomal protein S8e, conserved site	IPR018283	-	-
Sma3	Dil domain	IPR018444	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT3G05140.1	RBK2 ROP binding protein kinases 2 chr3:1435817-1437800 REVERSE LENGTH=460	1.00053e-42	71%
RefSeq	Arabidopsis thaliana	NP_187165.2	ROP binding protein kinase 2 [Arabidopsis thaliana]	1.99965e-42	71%
RefSeq	Populus trichocarpa	XP_002314440.1	predicted protein, partial [Populus trichocarpa]	7.9874e-44	69%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: D5A9D1

Fln msg: Distance to subject end: 85 aas, your sequence is shorter than subject: 103 - 347

Fln protein: RRDLGCHSILLTENFDPQISDFGLAKWLPKPWTHLILTAAIEGTFGYLAPEYVMHGIVDEKTDVFAFGVLLLELITGRLPIDSSQQSLVMWAKPLLERRSIQK

Protein Length: 104

Fln nts: CGTCGTGACCTTGGCTGTCACTCAATTTTACTCACTGAGAATTTTGACCCACAGATTTCAGATTTTGGACTAGCAAAGTGGCTACCGAAGCCATGGACACACCTGATATTAACAGCTGCTATTGAAGGCACGTTTGGCTATCTTGCCCCAGAGTATGTCATGCATGGGATTGTTGATGAGAAAACAGATGTTTTCGCATTTGGTGTACTTCTGCTGGAGCTCATTACTGGTCGCCTTCCAATTGACTCTTCTCAGCAAAGCTTAGTGATGTGGGCAAAGCCTCTGCTTGAACGTAGAAGCATTCAGAAGCT

Fln Alignment:

GG46A6U02FQ8A7___RDLGCHSILLTENFDPQISDFGLAKWLPKPWTHLILTAAIEGTFGYLAPEYVMHGIVDEKTDVFAFGVLLLELITGRLPIDSSQQSLVMWAKPLLERRSIQK
D5A9D1_______________RDIKSSNVLLGKDFEPQISDFGLSKWLPRQWTHHSVTP-IEGTFGYLAPEYFLHGIVDEKTDVFSFGVLLLEIISGRRPIDASEQNILSWAKPLMESGNIHE

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain