|
||||||
|
UniGene Name: sp_v3.0_unigene72246
Length: 200 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene72246
C |
|
Ace file of the UniGene sp_v3.0_unigene72246
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | pullulanase-like protein (starch debranching enzyme) [Arabidopsis thaliana] | - | - | 1.0e-17 | 75% |
| FL-Next | sp=Pullulanase 1, chloroplastic; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 75% |
| Sma3 | Pullulanase-type starch debranching enzyme | - | - | 2.502e-08 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Pullulanase. | EC:3.2.1.41 | - | 4.169e-08 | - |
| Source | Gene names |
|---|---|
| Sma3 | At5g04360; CHLREDRAFT_17807; GSVIVT00018110001; HvLD99; LD1; OSJNBa0019G23.2; OSTLU_39745; Os04g0164900; OsI_14800; OsJ_13773; Ot01g03030; PHYPADRAFT_167283; POPTRDRAFT_833878; PUL1; PULSPO; RCOM_0442550; spu; zpu1; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
| Sma3 | limit dextrinase activity | GO:0010303 | Molecular Function | 0.0 | - |
| Sma3 | carbohydrate binding | GO:0030246 | Molecular Function | 0.0 | - |
| Sma3 | cation binding | GO:0043169 | Molecular Function | 0.0 | - |
| Sma3 | pullulanase activity | GO:0051060 | Molecular Function | 0.0 | - |
| Sma3 | carbohydrate metabolic process | GO:0005975 | Biological Process | 0.0 | - |
| Sma3 | starch catabolic process | GO:0005983 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Regulator of chromosome condensation, RCC1 | IPR000408 | - | 0.0 | - |
| Sma3 | Glycoside hydrolase, family 13, N-terminal | IPR004193 | - | 0.0 | - |
| Sma3 | Bacterial pullanase-associated domain | IPR005323 | - | 0.0 | - |
| Sma3 | Glycosyl hydrolase, family 13, catalytic domain | IPR006047 | - | 0.0 | - |
| Sma3 | Alpha-1,6-glucosidases, pullulanase-type | IPR011839 | - | 0.0 | - |
| Sma3 | Glycoside hydrolase, subgroup, catalytic domain | IPR013781 | - | 0.0 | - |
| Sma3 | Immunoglobulin-like fold | IPR013783 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G04360.1 | ATPU1, ATLDA, PU1, LDA limit dextrinase chr5:1221566-1228399 FORWARD LENGTH=965 | 1.0e-22 | 75% |
| RefSeq | Arabidopsis thaliana | NP_196056.2 | protein limit dextrinase [Arabidopsis thaliana] | 1.0e-22 | 75% |
| RefSeq | Populus trichocarpa | XP_002315334.1 | predicted protein [Populus trichocarpa] | 1.0e-23 | 76% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q8GTR4
Fln msg: Distance to subject end: 451 aas, your sequence is shorter than subject: 66 - 965
Fln protein:
R
Protein Length:
67
Fln nts:
C
Fln Alignment:
GG46A6U02GOHYJ___RTLEFRQMVQALNSIGLRVIVDVVYNHLHASGPNDKDSILDKVVPGYYLRRNT
Q8GTR4_______________RIIEFRKMVQALNCTGLNVVLDVVYNHLHASGPHDKESVLDKIVPGYYLRRNS
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
