|
||||||
|
UniGene Name: sp_v3.0_unigene72114
Length: 229 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene72114
G |
|
Ace file of the UniGene sp_v3.0_unigene72114 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | RVT_2 domain containing protein | - | - | 3.0e-31 | 66% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 63% |
| Sma3 | Retrotransposon protein, putative, Ty1-copia subclass | - | - | 3.176e-27 | - |
| Source | Gene names |
|---|---|
| Sma3 | At2g16000; BA4; F19K19.5; LOC_Os03g02500; LOC_Os03g11850; LOC_Os03g14349; LOC_Os03g21419; LOC_Os03g29130; LOC_Os03g30450; LOC_Os03g31200; LOC_Os03g37650; LOC_Os03g56676; LOC_Os10g02960; LOC_Os10g03300; LOC_Os10g19280; LOC_Os10g21730; LOC_Os10g31220; LOC_O |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
| Sma3 | CCAAT-binding factor complex | GO:0016602 | Cellular Component | 0.0 | - |
| Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | sequence-specific DNA binding transcription factor activity | GO:0003700 | Molecular Function | 0.0 | - |
| Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
| Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
| Sma3 | transferase activity, transferring hexosyl groups | GO:0016758 | Molecular Function | 0.0 | - |
| Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
| Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G23160.1 | CRK8 cysteine-rich RLK (RECEPTOR-like protein kinase) 8 chr4:12129485-12134086 FORWARD LENGTH=1262 | 2.0e-22 | 55% |
| RefSeq | Arabidopsis thaliana | NP_194047.2 | cysteine-rich receptor-like protein kinase 8 [Arabidopsis thaliana] | 2.0e-22 | 55% |
| Full-Lengther Next Prediction |
|---|
Fln status: Putative N-terminus
Fln database: coniferopsida.fasta
Fln subject: B8LKV8
Fln msg: Distance to subject end: 284 aas, atg_distance in limit (1-15): atg_distance = 4, W2: There is no M at the beginning, your sequence is shorter than subject: 76 - 363
Fln protein:
E
Protein Length:
77
Fln nts:
G
Fln Alignment:
GG46A6U02HAKAA___EYDALFKNGTWKLVDLPNGIKPIGCKWVYKTKYKVDGSLDKHKARLAAKGYAQKEGVDYTETFSPTAKL
B8LKV8_______________EMESIKKNDTWDLVDLPKEKECISVKWVYKTKYKANGELDKHKARLVAKGFAQEYGVDYNETFAPVARL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
