|
||||||
|
UniGene Name: sp_v3.0_unigene72090
Length: 207 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene72090
C |
|
Ace file of the UniGene sp_v3.0_unigene72090
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Pentatricopeptide repeat protein 65 n=2 Tax=Funariaceae RepID=F5CAD8_FUNHY | - | - | 2.0e-22 | 75% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 77% |
| Sma3 | Pentatricopeptide, putative, expressed | - | - | 5.21e-10 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g04840; At1g20230; At1g47580; At1g56690; At2g02980; At2g15690; At2g22070; At3g02010; At3g12770; At3g23330; At3g24000; At3g26782; At3g49170; At3g57430; At3g62890; At4g16835; At4g21065; At4g30700; At4g32450; At4g33170; At4g33990; At5g06540; At5g48910; At |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | ribosome | GO:0005840 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
| Sma3 | structural constituent of ribosome | GO:0003735 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | methyltransferase activity | GO:0008168 | Molecular Function | 0.0 | - |
| Sma3 | acireductone synthase activity | GO:0043874 | Molecular Function | 0.0 | - |
| Sma3 | metal ion binding | GO:0046872 | Molecular Function | 0.0 | - |
| Sma3 | DNA methylation | GO:0006306 | Biological Process | 0.0 | - |
| Sma3 | translation | GO:0006412 | Biological Process | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
| Sma3 | embryo development ending in seed dormancy | GO:0009793 | Biological Process | 0.0 | - |
| Sma3 | L-methionine salvage from methylthioadenosine | GO:0019509 | Biological Process | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G22070.1 | pentatricopeptide (PPR) repeat-containing protein chr2:9383602-9385962 FORWARD LENGTH=786 | 1.0e-27 | 76% |
| RefSeq | Arabidopsis thaliana | NP_179798.1 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 2.0e-27 | 76% |
| RefSeq | Populus trichocarpa | XP_002308660.1 | predicted protein [Populus trichocarpa] | 1.0e-27 | 74% |
| Full-Lengther Next Prediction |
|---|
Fln status: C-terminus
Fln database: coniferopsida.fasta
Fln subject: D5AAE0
Fln msg: your sequence is shorter than subject: 68 - 246
Fln protein:
V
Protein Length:
69
Fln nts:
C
Fln Alignment:
GG46A6U02H3IIH___LISTPPGILIRIVKNLRICGDCHTAIKFISKVVGREIVVRDASRFHHFKDGLCSCSDYW
D5AAE0_______________LISTLPGLPVRIIKNLRVCGDCHTATKFISKIVEREIIIRDANRFHHFKDGLCSCGDYW
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
