|
||||||
|
UniGene Name: sp_v3.0_unigene72085
Length: 137 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene72085
C |
|
Ace file of the UniGene sp_v3.0_unigene72085
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | ATP-binding cassette transporter, putative n=1 Tax=Ricinus communis RepID=B9RJZ7_RICCO | - | - | 8.0e-11 | 77% |
| FL-Next | sp=Putative pleiotropic drug resistance protein 7; Oryza sativa subsp. japonica (Rice). | - | - | 0.0 | 82% |
| Sma3 | ATP-binding cassette transporter, putative | - | - | 3.493e-25 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Phosphonate-transporting ATPase. | EC:3.6.3.28 | - | 1.437e-17 | - |
| Sma3 | Polyamine-transporting ATPase. | EC:3.6.3.31 | - | 2.828e-06 | - |
| Sma3 | Heme-transporting ATPase. | EC:3.6.3.41 | - | 3.635e-06 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g15520; At2g26910; B1045F02.15; B1090H08.39; F12C20.5; GSVIVT00032522001; GSVIVT00032575001; GSVIVT00032581001; GSVIVT00034492001; GSVIVT00034494001; GSVIVT00034498001; GSVIVT00034502001; GSVIVT00034509001; GSVIVT00034512001; GSVIVT00034520001; GSVIVT0 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | ATPase activity | GO:0016887 | Molecular Function | 0.0 | - |
| Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
| Sma3 | defense response | GO:0006952 | Biological Process | 0.0 | - |
| Sma3 | response to biotic stimulus | GO:0009607 | Biological Process | 0.0 | - |
| Sma3 | response to ethylene stimulus | GO:0009723 | Biological Process | 0.0 | - |
| Sma3 | response to salicylic acid stimulus | GO:0009751 | Biological Process | 0.0 | - |
| Sma3 | response to jasmonic acid stimulus | GO:0009753 | Biological Process | 0.0 | - |
| Sma3 | response to ozone | GO:0010193 | Biological Process | 0.0 | - |
| Sma3 | lead ion transport | GO:0015692 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ribosomal protein L11 | IPR000911 | - | 0.0 | - |
| Sma3 | ABC transporter-like | IPR003439 | - | 0.0 | - |
| Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
| Sma3 | ABC-2 type transporter | IPR013525 | - | 0.0 | - |
| Sma3 | Plant PDR ABC transporter associated | IPR013581 | - | 0.0 | - |
| Sma3 | ABC transporter, conserved site | IPR017871 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G26910.1 | PDR4, ATPDR4 pleiotropic drug resistance 4 chr2:11481623-11487874 FORWARD LENGTH=1420 | 4.0e-14 | 79% |
| RefSeq | Arabidopsis thaliana | NP_180259.1 | ABC transporter G family member 32 [Arabidopsis thaliana] | 5.0e-14 | 79% |
| RefSeq | Populus trichocarpa | XP_002304714.1 | predicted protein [Populus trichocarpa] | 3.0e-15 | 79% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q8GU88
Fln msg: Distance to subject end: 722 aas, your sequence is shorter than subject: 45 - 1444
Fln protein:
V
Protein Length:
46
Fln nts:
C
Fln Alignment:
GG46A6U02J5CA9___LLSRHDIKGWWIWGYWISPLMYAQNAISVNEFLG
Q8GU88_______________LISRENIKKWWIWGYWSSPLMYAQNAIAVNEFLG
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
