UniGene Name: sp_v3.0_unigene72076
Length: 186 nt
UniGene Fasta |
---|
>sp_v3.0_unigene72076
C |
Ace file of the UniGene sp_v3.0_unigene72076 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Similar to gb|AF049930 PGP237-11 from Petunia x hybrida and contains a PF|00097 Zinc (RING) finger domain [Arabidopsis thaliana] gb|AAS47676.1| At1g74760 [Arabidopsis thaliana] gb|AAZ14062.1| At1g74760 [Arabidopsis thaliana] | - | - | 9.0e-11 | 75% |
FL-Next | tr=Predicted protein; subsp. trichocarpa). | - | - | 0.0 | 90% |
Source | Gene names |
---|---|
Sma3 | At1g74760; At1g74770; At3g18290; F25A4.27; GSVIVT00000067001; GSVIVT00017711001; GSVIVT00030372001; LjnsRING; OSJNBa0079H23.4; Os05g0551000; OsI_03330; OsI_20887; OsJ_03068; OsJ_19457; PHYPADRAFT_129609; POPTRDRAFT_1085081; POPTRDRAFT_1101141; POPTRDRAFT_ |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | ligase activity | GO:0016874 | Molecular Function | 0.0 | - |
Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Peptidase S8/S53, subtilisin/kexin/sedolisin | IPR000209 | - | 0.0 | - |
Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Zinc finger, RING-type | IPR001841 | - | 0.0 | - |
Sma3 | Zinc finger, MIZ-type | IPR004181 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | Zinc finger, CHY-type | IPR008913 | - | 0.0 | - |
Sma3 | Haemerythrin/HHE cation-binding motif | IPR012312 | - | 0.0 | - |
Sma3 | EGF-like region, conserved site | IPR013032 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - | |
Sma3 | Zinc finger, CTCHY-type | IPR017921 | - | 0.0 | - |
Sma3 | Zinc finger, C3HC4 RING-type | IPR018957 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G74770.1 | zinc ion binding chr1:28089695-28094834 REVERSE LENGTH=1259 | 7.0e-15 | 75% |
RefSeq | Arabidopsis thaliana | NP_177615.2 | zinc ion binding protein [Arabidopsis thaliana] | 1.0e-14 | 75% |
RefSeq | Populus trichocarpa | XP_002312411.1 | predicted protein [Populus trichocarpa] | 5.0e-16 | 90% |
Full-Lengther Next Prediction |
---|
Fln status: C-terminus
Fln database: tr_plants
Fln subject: B9HJ50
Fln msg: Unexpected stop codon in the beginning of your sequence, your sequence is shorter than subject: 40 - 1037
Fln protein:
S
Protein Length:
41
Fln nts:
C
Fln Alignment:
GG46A6U02JBB68___ILCNDCQKKGTAPFHWLYHKCTTCGSYNTRVI
B9HJ50_______________ILCNDCDKKGTAPFHWLYHKCRLCGSYNTRVI
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain