|
||||||
|
UniGene Name: sp_v3.0_unigene72052
Length: 232 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene72052
C |
|
Ace file of the UniGene sp_v3.0_unigene72052
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | kinesin-like protein [Arabidopsis thaliana] | - | - | 1.0e-14 | 77% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 98% |
| Sma3 | Kinesin-1 | - | - | 1.725e-08 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT4g05190; ATK1; ATK2; ATK3; At4g05190; At4g21270; At4g27180; At5g54670; B1317D11.110; CHLREDRAFT_102475; F7J7.210; GSVIVT00012554001; GSVIVT00012976001; GSVIVT00027435001; K5F14.1; KATA; KATB; KATC; KIN11; KIN6; MICPUN_84915; MRB17.18; OSJNBa0033P04.11; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | minus-end kinesin complex | GO:0005872 | Cellular Component | 0.0 | - |
| Sma3 | microtubule | GO:0005874 | Cellular Component | 0.0 | - |
| Sma3 | microtubule associated complex | GO:0005875 | Cellular Component | 0.0 | - |
| Sma3 | spindle microtubule | GO:0005876 | Cellular Component | 0.0 | - |
| Sma3 | phragmoplast | GO:0009524 | Cellular Component | 0.0 | - |
| Sma3 | microtubule motor activity | GO:0003777 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | microtubule binding | GO:0008017 | Molecular Function | 0.0 | - |
| Sma3 | minus-end-directed microtubule motor activity | GO:0008569 | Molecular Function | 0.0 | - |
| Sma3 | ATPase activity | GO:0016887 | Molecular Function | 0.0 | - |
| Sma3 | microtubule-based movement | GO:0007018 | Biological Process | 0.0 | - |
| Sma3 | mitosis | GO:0007067 | Biological Process | 0.0 | - |
| Sma3 | anastral spindle assembly involved in male meiosis | GO:0009971 | Biological Process | 0.0 | - |
| Sma3 | spindle assembly | GO:0051225 | Biological Process | 0.0 | - |
| Sma3 | cell division | GO:0051301 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Kinesin, motor domain | IPR001752 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G05190.1 | ATK5 kinesin 5 chr4:2675338-2679482 FORWARD LENGTH=790 | 3.0e-19 | 77% |
| RefSeq | Arabidopsis thaliana | NP_192428.2 | kinesin 5 [Arabidopsis thaliana] | 4.0e-19 | 77% |
| RefSeq | Populus trichocarpa | XP_002319271.1 | predicted protein [Populus trichocarpa] | 1.0e-17 | 75% |
| Full-Lengther Next Prediction |
|---|
Fln status: Complete
Fln database: coniferopsida.fasta
Fln subject: D5AAY4
Fln msg:
Fln protein:
M
Protein Length:
53
Fln nts:
C
Fln Alignment:
GG46A6U02F9DQI___MFVNISPDPKSFGETLCSLRFAAKVNACEIGVPRRQTNSRVSDAHGRLSSC
D5AAY4_______________MFVNISPDPKSFGESLCSLRFAAKVNACEIGVPRRQTNSRVSDAHGRLSSC
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
