UniGene Name: sp_v3.0_unigene71951
Length: 173 nt
UniGene Fasta |
---|
>sp_v3.0_unigene71951
C |
Ace file of the UniGene sp_v3.0_unigene71951 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Chaperonin containing t-complex protein 1, beta subunit, tcpb, putative n=1 Tax=Ricinus communis RepID=B9R8I3_RICCO | - | - | 4.0e-16 | 86% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 59% |
Sma3 | T-complex protein 1, alpha subunit | - | - | 4.149e-25 | - |
Source | Gene names |
---|---|
Sma3 | At3g11830; At3g20050; At5g20890; CCT1; CCT2; CCT7; CHLREDRAFT_116746; CHLREDRAFT_184701; F26K24.12; GSVIVT00015538001; GSVIVT00019150001; LOC_Os03g42220; MICPUCDRAFT_44294; MICPUCDRAFT_45559; MICPUCDRAFT_46385; MICPUN_108805; MICPUN_90096; OSJNBa0010H02.6 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | anchored to plasma membrane | GO:0046658 | Cellular Component | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | unfolded protein binding | GO:0051082 | Molecular Function | 0.0 | - |
Sma3 | protein folding | GO:0006457 | Biological Process | 0.0 | - |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | RNA helicase, ATP-dependent, DEAD-box, conserved site | IPR000629 | - | 0.0 | - |
Sma3 | Chaperonin TCP-1, conserved site | IPR002194 | - | 0.0 | - |
Sma3 | Chaperonin Cpn60/TCP-1 | IPR002423 | - | 0.0 | - |
Sma3 | T-complex protein 1, alpha subunit | IPR012715 | - | 0.0 | - |
Sma3 | T-complex protein 1, beta subunit | IPR012716 | - | 0.0 | - |
Sma3 | T-complex protein 1, delta subunit | IPR012717 | - | 0.0 | - |
Sma3 | T-complex protein 1, epsilon subunit | IPR012718 | - | 0.0 | - |
Sma3 | T-complex protein 1, eta subunit | IPR012720 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | Chaperone, tailless complex polypeptide 1 | IPR017998 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G20890.1 | TCP-1/cpn60 chaperonin family protein chr5:7087020-7089906 REVERSE LENGTH=527 | 6.0e-22 | 97% |
RefSeq | Arabidopsis thaliana | NP_197589.1 | TCP-1/cpn60 chaperonin family protein [Arabidopsis thaliana] | 7.0e-22 | 97% |
RefSeq | Populus trichocarpa | XP_002298565.1 | predicted protein [Populus trichocarpa] | 3.0e-21 | 95% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5A831
Fln msg: Distance to subject end: 450 aas, your sequence is shorter than subject: 57 - 556
Fln protein:
V
Protein Length:
58
Fln nts:
C
Fln Alignment:
GG46A6U02GZTEY___VTVTNDGATILKSLHIDNPAAKVMVDISKVQDDEVGDGTTSVVV
D5A831_______________IVVTNDGNAILRELDLAHPAAKSMIELSRTQDEEVGDGTTSVIV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain