|
||||||
|
UniGene Name: sp_v3.0_unigene71925
Length: 158 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene71925
C |
|
Ace file of the UniGene sp_v3.0_unigene71925
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Enhancer of zeste, ezh, putative n=1 Tax=Ricinus communis RepID=B9RNE0_RICCO | - | - | 1.0e-16 | 86% |
| FL-Next | sp=Histone-lysine N-methyltransferase EZ1; Zea mays (Maize). | - | - | 0.0 | 88% |
| Sma3 | Enhancer of zeste, ezh, putative | - | - | 1.062e-08 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Histone-lysine N-methyltransferase. | EC:2.1.1.43 | - | 1.124e-16 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Lysine degradation | 00310 | 1.124e-16 | % |
| Source | Gene names |
|---|---|
| Sma3 | At2g23380; At4g02020; CLF; EZ1; EZ2; EZ3; EZA1; F26B6.3; GSVIVT00019523001; GSVIVT00028115001; ICU1; LOC_Os03g19480; MEZ1; MEZ2; MEZ3; MICPUCDRAFT_59369; MICPUN_63548; Os03g0307800; Os06g0275500; OsI_11249; OsI_22514; OsJ_10569; OsJ_20958; P0038C05.29; P0 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | histone-lysine N-methyltransferase activity | GO:0018024 | Molecular Function | 0.0 | - |
| Sma3 | regulation of gene expression by genetic imprinting | GO:0006349 | Biological Process | 0.0 | - |
| Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
| Sma3 | DNA mediated transformation | GO:0009294 | Biological Process | 0.0 | - |
| Sma3 | flower development | GO:0009908 | Biological Process | 0.0 | - |
| Sma3 | endosperm development | GO:0009960 | Biological Process | 0.0 | - |
| Sma3 | leaf morphogenesis | GO:0009965 | Biological Process | 0.0 | - |
| Sma3 | histone methylation | GO:0016571 | Biological Process | 0.0 | - |
| Sma3 | cell differentiation | GO:0030154 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | SANT/Myb domain | IPR001005 | - | 0.0 | - |
| Sma3 | von Willebrand factor, type C | IPR001007 | - | 0.0 | - |
| Sma3 | SET domain | IPR001214 | - | 0.0 | - |
| Sma3 | Adenosine/AMP deaminase active site | IPR006650 | - | 0.0 | - |
| Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G23380.1 | CLF, ICU1, SDG1, SET1 SET domain-containing protein chr2:9955570-9960117 FORWARD LENGTH=902 | 3.0e-21 | 86% |
| RefSeq | Arabidopsis thaliana | NP_179919.1 | histone-lysine N-methyltransferase CLF [Arabidopsis thaliana] | 4.0e-21 | 86% |
| RefSeq | Populus trichocarpa | XP_002310129.1 | SET domain protein [Populus trichocarpa] | 3.0e-21 | 86% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q8S4P6
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 101 aas, your sequence is shorter than subject: 52 - 931
Fln protein:
S
Protein Length:
53
Fln nts:
C
Fln Alignment:
GG46A6U02HWO4Z___NVAGWGAFLKNPVNKHEYLGEYTGELISHKEADKRGKIYDREDSS
Q8S4P6_______________DVSGWGAFLKNSVSKHEYLGEYTGELISHKEADKRGKIYDRENSS
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
