UniGene Name: sp_v3.0_unigene71915
Length: 160 nt
![]() |
---|
>sp_v3.0_unigene71915
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Putative MAP kinase n=1 Tax=Papaver rhoeas RepID=Q683Y6_9MAGN | - | - | 1.0e-08 | 77% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 81% |
Sma3 | Mitogen-activated protein kinase 6 | - | - | 5.335e-08 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Mitogen-activated protein kinase. | EC:2.7.11.24 | - | 2.983e-08 | - |
Source | Gene names |
---|---|
Sma3 | At2g43790; ERK1; F18O19.10; GSVIVT00034702001; LOC_Os06g06090; MAPK6; MK2; MMK1; MPK1; MPK2; MPK6; MPK7; MSK7; NTF4; NbNTF4; NbSIPK; NtSIPK; OSJNBa0085L11.14; Os06g0154500; OsI_21727; OsJ_20171; POPTRDRAFT_718188; POPTRDRAFT_735966; RCOM_0723010; SIPK; St |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | MAP kinase activity | GO:0004707 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | response to cold | GO:0009409 | Biological Process | 0.0 | - |
Sma3 | plant-type hypersensitive response | GO:0009626 | Biological Process | 0.0 | - |
Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
Sma3 | response to ethylene stimulus | GO:0009723 | Biological Process | 0.0 | - |
Sma3 | response to abscisic acid stimulus | GO:0009737 | Biological Process | 0.0 | - |
Sma3 | induced systemic resistance, jasmonic acid mediated signaling pathway | GO:0009864 | Biological Process | 0.0 | - |
Sma3 | camalexin biosynthetic process | GO:0010120 | Biological Process | 0.0 | - |
Sma3 | response to hydrogen peroxide | GO:0042542 | Biological Process | 0.0 | - |
Sma3 | ovule development | GO:0048481 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Serine/threonine- / dual-specificity protein kinase, catalytic domain | IPR002290 | - | 0.0 | - |
Sma3 | MAP kinase, conserved site | IPR003527 | - | 0.0 | - |
Sma3 | Dihydroneopterin aldolase/epimerase domain | IPR006157 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | JNK MAP kinase | IPR008351 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G43790.1 | ATMPK6, MPK6, MAPK6, ATMAPK6 MAP kinase 6 chr2:18138477-18140693 FORWARD LENGTH=395 | 5.0e-13 | 74% |
RefSeq | Arabidopsis thaliana | NP_181907.1 | mitogen-activated protein kinase 6 [Arabidopsis thaliana] | 6.0e-13 | 74% |
RefSeq | Populus trichocarpa | XP_002310398.1 | predicted protein [Populus trichocarpa] | 4.0e-13 | 75% |
![]() |
---|
Fln status: C-terminus
Fln database: coniferopsida.fasta
Fln subject: B8LQ04
Fln msg: your sequence is shorter than subject: 45 - 277
Fln protein:
R
Protein Length:
46
Fln nts:
C
Fln Alignment:
GG46A6U02I2O8Q___SCPVPFNFDFEQHALTEEQMRELIYMEALAFNP
B8LQ04_______________TCPIPFNFEFEEHALTEEQMRELIYREALEFNP
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain