|
||||||
|
UniGene Name: sp_v3.0_unigene71880
Length: 176 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene71880
C |
|
Ace file of the UniGene sp_v3.0_unigene71880
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Asymmetric leaves 2 n=1 Tax=Carica papaya RepID=A7L4B2_CARPA | - | - | 2.0e-19 | 90% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 64% |
| Sma3 | LOB domain-containing protein, putative | - | - | 8.805e-15 | - |
| Source | Gene names |
|---|---|
| Sma3 | AS2; ASL1; ASL2; ASL3; ASL4; ASL5; ASL6; ASL9; B1164G01.6; CRLL3; CRLL4; GSVIVT00009328001; GSVIVT00009702001; GSVIVT00009703001; GSVIVT00009704001; GSVIVT00016010001; GSVIVT00020677001; GSVIVT00024029001; GSVIVT00025687001; GSVIVT00029332001; GSVIVT00029 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | monolayer-surrounded lipid storage body outer lipid monolayer | GO:0034430 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | multicellular organismal development | GO:0007275 | Biological Process | 0.0 | - |
| Sma3 | specification of symmetry | GO:0009799 | Biological Process | 0.0 | - |
| Sma3 | polarity specification of adaxial/abaxial axis | GO:0009944 | Biological Process | 0.0 | - |
| Sma3 | proximal/distal pattern formation | GO:0009954 | Biological Process | 0.0 | - |
| Sma3 | leaf morphogenesis | GO:0009965 | Biological Process | 0.0 | - |
| Sma3 | organ boundary specification between lateral organs and the meristem | GO:0010199 | Biological Process | 0.0 | - |
| Sma3 | GO:0045449 | Biological Process | 0.0 | - | |
| Sma3 | petal development | GO:0048441 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Oleosin | IPR000136 | - | 0.0 | - |
| Sma3 | Peptidase, cysteine peptidase active site | IPR000169 | - | 0.0 | - |
| Sma3 | Hydroxymethylglutaryl-CoA reductase, class I/II | IPR002202 | - | 0.0 | - |
| Sma3 | Lateral organ boundaries, LOB | IPR004883 | - | 0.0 | - |
| Sma3 | Asymmetric leaves, AS2/LOB | IPR017414 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G65620.1 | AS2 Lateral organ boundaries (LOB) domain family protein chr1:24400146-24400745 FORWARD LENGTH=199 | 5.0e-27 | 90% |
| RefSeq | Arabidopsis thaliana | NP_001117553.1 | LOB domain-containing protein 6 [Arabidopsis thaliana] | 6.0e-27 | 90% |
| RefSeq | Populus trichocarpa | XP_002322187.1 | predicted protein, partial [Populus trichocarpa] | 3.0e-27 | 90% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9P2E3
Fln msg: Distance to subject end: 96 aas, your sequence is shorter than subject: 58 - 179
Fln protein:
R
Protein Length:
59
Fln nts:
C
Fln Alignment:
GG46A6U02FNCNC___YFPPDQPQKFANVHKIFGASNVTKLLNELHPHQREDAVNSLAYEADARVK
A9P2E3_______________YFSPHEPQKFASVHKIFGASNVSKMLMEVPESQRSDTANSLVYEANARLR
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
