UniGene Name: sp_v3.0_unigene71870
Length: 199 nt
UniGene Fasta |
---|
>sp_v3.0_unigene71870
C |
Ace file of the UniGene sp_v3.0_unigene71870 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | alpha-mannosidase [Arabidopsis thaliana] emb|CAA66821.1| alpha-mannosidase [Arabidopsis thaliana] emb|CAA72432.1| alpha-mannosidase precursor [Arabidopsis thaliana] dbj|BAB01735.1| alpha-mannosidase [Arabidopsis thaliana] gb|AAK62592.1| AT3g26720/MLJ15_12 | - | - | 2.0e-15 | 66% |
FL-Next | tr=Predicted protein; Physcomitrella patens subsp. patens (Moss). | - | - | 0.0 | 64% |
Sma3 | Lysosomal alpha-mannosidase, putative | - | - | 6.903e-08 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Alpha-mannosidase. | EC:3.2.1.24 | - | 1.449e-07 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Other glycan degradation | 00511 | 1.449e-07 | % |
Source | Gene names |
---|---|
Sma3 | AT3G26720; At3g26720; GSVIVT00017734001; GSVIVT00018036001; GSVIVT00036759001; GSVIVT00037952001; GSVIVT00037953001; LOC_Os10g05069; LOC_Os11g32260; OSJNAa0029P06.4; OSJNBa0029P06.15; Os10g0140200; Os11g0525600; OsI_32713; OsI_36309; OsJ_30682; OsJ_34079; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | alpha-mannosidase activity | GO:0004559 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | carbohydrate binding | GO:0030246 | Molecular Function | 0.0 | - |
Sma3 | carbohydrate metabolic process | GO:0005975 | Biological Process | 0.0 | - |
Sma3 | mannose metabolic process | GO:0006013 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Glycoside hydrolase, family 38, core | IPR000602 | - | 0.0 | - |
Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
Sma3 | Sugar transporter, conserved site | IPR005829 | - | 0.0 | - |
Sma3 | Glycosyl hydrolases 38, C-terminal | IPR011682 | - | 0.0 | - |
Sma3 | Reverse transcriptase, RNA-dependent DNA polymerase | IPR013103 | - | 0.0 | - |
Sma3 | Glycosyl hydrolase, family 13, all-beta | IPR013780 | - | 0.0 | - |
Sma3 | Glycoside hydrolase, family 38, central domain | IPR015341 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G26720.1 | Glycosyl hydrolase family 38 protein chr3:9816707-9823056 FORWARD LENGTH=1019 | 4.0e-20 | 66% |
RefSeq | Arabidopsis thaliana | NP_001118706.1 | alpha-mannosidase [Arabidopsis thaliana] | 5.0e-20 | 66% |
RefSeq | Populus trichocarpa | XP_002321075.1 | predicted protein [Populus trichocarpa] | 9.0e-20 | 63% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: tr_plants
Fln subject: A9SGT5
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 889 aas, your sequence is shorter than subject: 52 - 1090
Fln protein:
R
Protein Length:
53
Fln nts:
C
Fln Alignment:
GG46A6U02FF96G___SYYVDMIDQTTLGHRFIKKEFGKVPRVGWQIDPFGHSAVSRFIF*VQRLDLEALFFARA
A9SGT5_______________THYVDMIDQTTLGHRFIKKQFGKIPRIAWQIDPFGHSAVQAYLLGAE-MGFDGLFFGRA
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain