|
||||||
|
UniGene Name: sp_v3.0_unigene71703
Length: 240 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene71703
C |
|
Ace file of the UniGene sp_v3.0_unigene71703
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | indole-3-acetic acid-amido synthetase GH3.6 [Arabidopsis thaliana] sp|Q9LSQ4.1|GH36_ARATH RecName: Full=Indole-3-acetic acid-amido synthetase GH3.6; AltName: Full=Auxin-responsive GH3-like protein 6; Short=AtGH3-6; AltName: Full=Protein DWARF IN LIGHT 1; | - | - | 5.0e-24 | 70% |
| FL-Next | tr=Auxin-induced GH3 protein; Pinus pinaster (Maritime pine). | - | - | 0.0 | 72% |
| Sma3 | GH3 family protein | - | - | 1.176e-23 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ligases, Forming carbon-nitrogen bonds, Acid--D-amino-acid ligases (peptide synthases). | EC:6.3.2.- | - | 1.113e-28 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Tryptophan metabolism | 00380 | 1.113e-28 | % | |
| Sma3 | Biosynthesis of siderophore group nonribosomal peptides | 01053 | 1.113e-28 | % |
| Source | Gene names |
|---|---|
| Sma3 | At1g28130; At1g59500; At1g59500 orthologue; At2g14960; At2g23170; At2g47750; At4g27260; At4g37390; At5g13350; At5g13360; At5g54510; B1070A12.26; CF4; DFL1; F13K9.22; F17A22.14; F24B18.13; F3H9.21; F3H9_19; F6G17.40; GH3; GH3-1; GH3-2; GH3-3; GH3-4; GH3-5; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
| Sma3 | indole-3-acetic acid amido synthetase activity | GO:0010279 | Molecular Function | 0.0 | - |
| Sma3 | ligase activity | GO:0016874 | Molecular Function | 0.0 | - |
| Sma3 | response to light stimulus | GO:0009416 | Biological Process | 0.0 | - |
| Sma3 | response to auxin stimulus | GO:0009733 | Biological Process | 0.0 | - |
| Sma3 | auxin mediated signaling pathway | GO:0009734 | Biological Process | 0.0 | - |
| Sma3 | unidimensional cell growth | GO:0009826 | Biological Process | 0.0 | - |
| Sma3 | auxin homeostasis | GO:0010252 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | GH3 auxin-responsive promoter | IPR004993 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G54510.1 | GH3.6, DFL1 Auxin-responsive GH3 family protein chr5:22131321-22133564 REVERSE LENGTH=612 | 3.0e-30 | 70% |
| RefSeq | Arabidopsis thaliana | NP_200262.1 | indole-3-acetic acid-amido synthetase GH3.6 [Arabidopsis thaliana] | 4.0e-30 | 70% |
| RefSeq | Populus trichocarpa | XP_002319260.1 | GH3 family protein [Populus trichocarpa] | 5.0e-31 | 72% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q4LAM0
Fln msg: Distance to subject end: 343 aas, your sequence is shorter than subject: 80 - 615
Fln protein:
R
Protein Length:
81
Fln nts:
C
Fln Alignment:
GG46A6U02GZ4W3___TSPNQAVLCHDSYQSMYSQLLCGLLQNNEVLRMGAVFASGFIRAIRFLEEHWKQFCLDIKTGILN-TEVTDP
Q4LAM0_______________TSPMEAILCSDSYQSMYCQLLCGLAQNHEVLRVGAVFASGLLRAIRFLEEHWQSLCQDIRSGTVNDEEVTDP
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
