|
||||||
|
UniGene Name: sp_v3.0_unigene71661
Length: 199 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene71661
T |
|
Ace file of the UniGene sp_v3.0_unigene71661 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | ethylene-responsive transcription factor ERF113 [Arabidopsis thaliana] sp|Q9LYU3.1|EF113_ARATH RecName: Full=Ethylene-responsive transcription factor ERF113 emb|CAB86640.1| putative protein [Arabidopsis thaliana] gb|AAS47615.1| At5g13330 [Arabidopsis thal | - | - | 5.0e-16 | 74% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 77% |
| Sma3 | AP2/ERF domain-containing transcription factor | - | - | 9.691e-37 | - |
| Source | Gene names |
|---|---|
| Sma3 | 24.t00040; ABR1; AP2DCP; AT1G53910; ATF2; At1g43160; At1g53910; At2g33710; At2g47520; At3g14230; At3g15210; At4g11140; At4g27950; At4g34410; At5g07310; At5g13330; At5g47220; At5g47230; At5g50080; At5g53290; At5g61890; At5g64750; B1011A07.39; B1045B05.13; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | nucleolus | GO:0005730 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | nuclear body | GO:0016604 | Cellular Component | 0.0 | - |
| Sma3 | sequence-specific DNA binding transcription factor activity | GO:0003700 | Molecular Function | 0.0 | - |
| Sma3 | phosphatidylinositol phospholipase C activity | GO:0004435 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | transcription activator activity | GO:0016563 | Molecular Function | 0.0 | - |
| Sma3 | transcription repressor activity | GO:0016564 | Molecular Function | 0.0 | - |
| Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
| Sma3 | lipid metabolic process | GO:0006629 | Biological Process | 0.0 | - |
| Sma3 | defense response | GO:0006952 | Biological Process | 0.0 | - |
| Sma3 | response to osmotic stress | GO:0006970 | Biological Process | 0.0 | - |
| Sma3 | GO:0007242 | Biological Process | 0.0 | - | |
| Sma3 | response to cold | GO:0009409 | Biological Process | 0.0 | - |
| Sma3 | cytokinin mediated signaling pathway | GO:0009736 | Biological Process | 0.0 | - |
| Sma3 | response to abscisic acid stimulus | GO:0009737 | Biological Process | 0.0 | - |
| Sma3 | response to glucose stimulus | GO:0009749 | Biological Process | 0.0 | - |
| Sma3 | negative regulation of abscisic acid mediated signaling pathway | GO:0009788 | Biological Process | 0.0 | - |
| Sma3 | induced systemic resistance, jasmonic acid mediated signaling pathway | GO:0009864 | Biological Process | 0.0 | - |
| Sma3 | ethylene mediated signaling pathway | GO:0009873 | Biological Process | 0.0 | - |
| Sma3 | negative regulation of ethylene mediated signaling pathway | GO:0010105 | Biological Process | 0.0 | - |
| Sma3 | response to chitin | GO:0010200 | Biological Process | 0.0 | - |
| Sma3 | transcription factor import into nucleus | GO:0042991 | Biological Process | 0.0 | - |
| Sma3 | GO:0045941 | Biological Process | 0.0 | - | |
| Sma3 | leaf development | GO:0048366 | Biological Process | 0.0 | - |
| Sma3 | cotyledon development | GO:0048825 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ornithine/DAP/Arg decarboxylase | IPR000183 | - | 0.0 | - |
| Sma3 | AP2/ERF domain | IPR001471 | - | 0.0 | - |
| Sma3 | Phospholipase C, phosphatidylinositol-specific, Y domain | IPR001711 | - | 0.0 | - |
| Sma3 | Enolpyruvate transferase domain | IPR001986 | - | 0.0 | - |
| Sma3 | Ubiquinol cytochrome reductase, transmembrane domain | IPR004192 | - | 0.0 | - |
| Sma3 | IPR004348 | - | 0.0 | - | |
| Sma3 | Rieske iron-sulphur protein, C-terminal | IPR005805 | - | 0.0 | - |
| Sma3 | IPR005806 | - | 0.0 | - | |
| Sma3 | Ubiquinol-cytochrome c reductase, iron-sulphur subunit | IPR006317 | - | 0.0 | - |
| Sma3 | Rieske iron-sulphur protein | IPR014349 | - | 0.0 | - |
| Sma3 | Rieske [2Fe-2S] iron-sulphur domain | IPR017941 | - | 0.0 | - |
| Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G13330.1 | Rap2.6L related to AP2 6l chr5:4272384-4274461 FORWARD LENGTH=212 | 4.0e-22 | 74% |
| RefSeq | Arabidopsis thaliana | NP_196837.1 | ethylene-responsive transcription factor ERF113 [Arabidopsis thaliana] | 5.0e-22 | 74% |
| RefSeq | Populus trichocarpa | XP_002318176.1 | AP2/ERF domain-containing transcription factor [Populus trichocarpa] | 2.0e-20 | 81% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9P288
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 259 aas, your sequence is shorter than subject: 59 - 429
Fln protein:
S
Protein Length:
60
Fln nts:
T
Fln Alignment:
GG46A6U02G0695___QEGISWKRDDELPQPQNPPKKKRYRGVRQRPWGKWAAEIRDPKKAARVWLGTFETAE
A9P288_______________EDDLSSKKKDELQVPQNSSKKRRYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTAE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
