UniGene Name: sp_v3.0_unigene71600
Length: 159 nt
UniGene Fasta |
---|
>sp_v3.0_unigene71600
C |
Ace file of the UniGene sp_v3.0_unigene71600 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | ubiquitin ligase SINAT5-related (seven in absentia protein family) [Musa balbisiana] | - | - | 2.0e-14 | 77% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 77% |
Sma3 | SINA6 | - | - | 1.1e-07 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Ligases, Forming carbon-nitrogen bonds, Acid--D-amino-acid ligases (peptide synthases). | EC:6.3.2.- | - | 1.37e-06 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Tryptophan metabolism | 00380 | 1.37e-06 | % | |
Sma3 | Biosynthesis of siderophore group nonribosomal peptides | 01053 | 1.37e-06 | % |
Source | Gene names |
---|---|
Sma3 | At2g41980; At3g58040; At3g61790; At4g27880; At5g53360; F15G16.180; GSVIVT00006731001; GSVIVT00024729001; GSVIVT00025405001; GSVIVT00031016001; GSVIVT00037258001; K19E1.16; LOC_Os03g24040; MBP_91N22.6; OJ1057_D08.24; OJ1122_B08.8; OJ1477_F01.127; Os01g0234 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | ubiquitin-protein ligase activity | GO:0004842 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | ubiquitin-dependent protein catabolic process | GO:0006511 | Biological Process | 0.0 | - |
Sma3 | multicellular organismal development | GO:0007275 | Biological Process | 0.0 | - |
Sma3 | protein ubiquitination | GO:0016567 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | F-box domain, cyclin-like | IPR001810 | - | 0.0 | - |
Sma3 | Zinc finger, RING-type | IPR001841 | - | 0.0 | - |
Sma3 | Seven-in-absentia protein, sina | IPR004162 | - | 0.0 | - |
Sma3 | Zinc finger, SIAH-type | IPR013010 | - | 0.0 | - |
Sma3 | TRAF-type | IPR013322 | - | 0.0 | - |
Sma3 | Seven In Absentia Homolog-type | IPR013323 | - | 0.0 | - |
Sma3 | Zinc finger, RING-type, conserved site | IPR017907 | - | 0.0 | - |
Sma3 | Seven-in-absentia protein, TRAF-like domain | IPR018121 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G41980.1 | Protein with RING/U-box and TRAF-like domains chr2:17523494-17524692 REVERSE LENGTH=305 | 9.0e-19 | 75% |
RefSeq | Arabidopsis thaliana | NP_181729.1 | ubiquitin-protein ligase SIAH1 [Arabidopsis thaliana] | 1.0e-18 | 75% |
RefSeq | Populus trichocarpa | XP_002303919.1 | predicted protein [Populus trichocarpa] | 2.0e-20 | 80% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NX30
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 70 aas, your sequence is shorter than subject: 52 - 323
Fln protein:
S
Protein Length:
53
Fln nts:
C
Fln Alignment:
GG46A6U02J6WKB___IENAIWMPTVINCFGQFFCLHFEAFLLDMAPVYIAFLIFMGDDNE
A9NX30_______________VENATWMLTVFHCFGQYFCLHFEAFQLGMAPVYMAFLRFMGDDNE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain