UniGene Name: sp_v3.0_unigene71523
Length: 207 nt
UniGene Fasta |
---|
>sp_v3.0_unigene71523
G |
Ace file of the UniGene sp_v3.0_unigene71523 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | H+-transporting ATPase-like protein [Arabidopsis thaliana] | - | - | 2.0e-10 | 71% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 71% |
Sma3 | Plasma membrane H+-ATPase | - | - | 8.5e-10 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Transferred entry: 3.6.3.6. | EC:3.6.1.35 | - | 9.869e-06 | - |
Sma3 | Proton-exporting ATPase. | EC:3.6.3.6 | - | 2.141e-12 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Oxidative phosphorylation | 00190 | 2.141e-12 | % |
Source | Gene names |
---|---|
Sma3 | AHA1; AHA11; AHA2; AHA3; AHA4; AHA5; AHA6; AHA7; AHA8; AHA9; AT4G30190; ATP1; Aa_42640; At1g80660; At2g07560; At2g24520; At3g42640; At3g47950; At3g60330; At4g30190; At5g57350; At5g62670; BHA-1; Cr_42640; DcPA 1; DcPA 2; DcPA 3; DcPA 4; DcPA 5; DcPA 6; F23 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | magnesium ion binding | GO:0000287 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | hydrogen-exporting ATPase activity, phosphorylative mechanism | GO:0008553 | Molecular Function | 0.0 | - |
Sma3 | ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism | GO:0015662 | Molecular Function | 0.0 | - |
Sma3 | ATPase activity, uncoupled | GO:0042624 | Molecular Function | 0.0 | - |
Sma3 | ATP biosynthetic process | GO:0006754 | Biological Process | 0.0 | - |
Sma3 | cation transport | GO:0006812 | Biological Process | 0.0 | - |
Sma3 | proton transport | GO:0015992 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | ATPase, P-type, H+ transporting proton pump | IPR000695 | - | 0.0 | - |
Sma3 | ATPase, P-type, K/Mg/Cd/Cu/Zn/Na/Ca/Na/H-transporter | IPR001757 | - | 0.0 | - |
Sma3 | ATPase, P-type cation-transporter, N-terminal | IPR004014 | - | 0.0 | - |
Sma3 | Haloacid dehalogenase-like hydrolase | IPR005834 | - | 0.0 | - |
Sma3 | ATPase, P-type, plasma-membrane proton-efflux | IPR006534 | - | 0.0 | - |
Sma3 | ATPase, P-type, ATPase-associated domain | IPR008250 | - | 0.0 | - |
Sma3 | Ribosomal protein S2, conserved site | IPR018130 | - | 0.0 | - |
Sma3 | ATPase, P-type phosphorylation site | IPR018303 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G62670.1 | AHA11, HA11 H(+)-ATPase 11 chr5:25159495-25164957 FORWARD LENGTH=956 | 4.0e-14 | 79% |
RefSeq | Arabidopsis thaliana | NP_201073.1 | H(+)-ATPase 11 [Arabidopsis thaliana] | 5.0e-14 | 79% |
RefSeq | Populus trichocarpa | XP_002318614.1 | autoinhibited H+ ATPase, partial [Populus trichocarpa] | 5.0e-14 | 79% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LQS1
Fln msg: Unexpected stop codon in the beginning of your sequence, Unexpected STOP codon at 3' end. Distance to subject end: 337 aas, your sequence is shorter than subject: 68 - 955
Fln protein:
N
Protein Length:
69
Fln nts:
G
Fln Alignment:
GG46A6U02GMXLO___EHKYKIIKRLHARKHICGMTDDSVNDAPALKKANIEIIV
B8LQS1_______________EHKYEIVRRLQEKKHICGMTGDGVNDAPALKKADIGIAV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain