UniGene Name: sp_v3.0_unigene71402
Length: 246 nt
UniGene Fasta |
---|
>sp_v3.0_unigene71402
C |
Ace file of the UniGene sp_v3.0_unigene71402 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | ACT-like protein tyrosine kinase family protein [Arabidopsis thaliana] gb|AEE86931.1| ACT-like protein tyrosine kinase family protein [Arabidopsis thaliana] | - | - | 2.0e-17 | 63% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 70% |
Sma3 | Protein kinase, putative | - | - | 6.473e-08 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Non-specific protein-tyrosine kinase. | EC:2.7.10.2 | - | 3.569e-06 | - |
Source | Gene names |
---|---|
Sma3 | AT4g35780; AT4g38470; At2g17700; At4g35780; CHLREDRAFT_105918; F20M13.30; F8D20.290; GSVIVT00002272001; GSVIVT00036186001; LOC_Os12g06670; Os07g0475900; Os09g0544300; Os12g0163800; OsI_25968; OsI_32244; OsI_37582; OsJ_24217; OsJ_30202; OsJ_35327; P0571D04 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | amino acid binding | GO:0016597 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Serine-threonine/tyrosine-protein kinase catalytic domain | IPR001245 | - | 0.0 | - |
Sma3 | Serine/threonine- / dual-specificity protein kinase, catalytic domain | IPR002290 | - | 0.0 | - |
Sma3 | Amino acid-binding ACT | IPR002912 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | IPR015783 | - | 0.0 | - | |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G38470.1 | ACT-like protein tyrosine kinase family protein chr4:17999432-18003551 FORWARD LENGTH=575 | 1.0e-19 | 63% |
RefSeq | Arabidopsis thaliana | NP_568041.1 | ACT-like protein tyrosine kinase family protein [Arabidopsis thaliana] | 1.0e-19 | 63% |
RefSeq | Populus trichocarpa | XP_002306961.1 | predicted protein [Populus trichocarpa] | 1.0e-19 | 63% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: C0PSF3
Fln msg: Separated hits, possible frame ERROR between 191 and 194, Unexpected stop codon in the beginning of your sequence, Distance to subject end: 195 aas, your sequence is shorter than subject: 81 - 594
Fln protein:
S
Protein Length:
82
Fln nts:
C
Fln Alignment:
GG46A6U02GL07V___LNRGRYLGQDVAVKVLKHECLNKELECEFSQEVMILRKVKHNNVVRFIGACTRPPNLxIVTEFLSGGSLYDYLHR
C0PSF3_______________LYRGTYCGQDVAIKVLKSERLDADLQREFAQEVFIMRKVRHKNVVQFIGACTRPPNLxIVTEFMSGGSVYDYLHK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain