UniGene Name: sp_v3.0_unigene71370
Length: 105 nt
![]() |
---|
>sp_v3.0_unigene71370
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Cytochrome P450 78A4 n=1 Tax=Pinus radiata RepID=C78A4_PINRA | - | - | 4.0e-12 | 100% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 91% |
Sma3 | Putative cytochrome P-450 | - | - | 9.766e-16 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | EC:1.14.-.- | - | 1.956e-07 | - | |
Sma3 | Flavonoid 3',5'-hydroxylase. | EC:1.14.13.88 | - | 2.688e-09 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Flavonoid biosynthesis | 00941 | 2.688e-09 | % | |
Sma3 | Flavone and flavonol biosynthesis | 00944 | 2.688e-09 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 2.688e-09 | % |
Source | Gene names |
---|---|
Sma3 | At1g13710; At1g74110; At3g61880; At5g09970; CYP78; CYP78A1; CYP78A11; CYP78A18; CYP78A20; CYP78A21v1; CYP78A21v2; CYP78A22; CYP78A23; CYP78A24; CYP78A25; CYP78A29; CYP78A3; CYP78A4; CYP78A9; CYP78D2; CYP78D3v1; F21F14.5; F21F14.50; F21F23.15; F2P9.2; GSVI |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | monooxygenase activity | GO:0004497 | Molecular Function | 0.0 | - |
Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Cytochrome P450 | IPR001128 | - | 0.0 | - |
Sma3 | Lipocalin | IPR002345 | - | 0.0 | - |
Sma3 | Cytochrome P450, E-class, group I | IPR002401 | - | 0.0 | - |
Sma3 | Cytochrome P450, E-class, group IV | IPR002403 | - | 0.0 | - |
Sma3 | Immunoglobulin-like | IPR007110 | - | 0.0 | - |
Sma3 | Inorganic pyrophosphatase | IPR008162 | - | 0.0 | - |
Sma3 | Cytochrome P450, conserved site | IPR017972 | - | 0.0 | - |
Sma3 | IPR017973 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G74110.1 | CYP78A10 cytochrome P450, family 78, subfamily A, polypeptide 10 chr1:27866667-27868368 REVERSE LENGTH=537 | 4.0e-13 | 81% |
RefSeq | Arabidopsis thaliana | NP_177551.1 | cytochrome P450, family 78, subfamily A, polypeptide 10 [Arabidopsis thaliana] | 6.0e-13 | 81% |
RefSeq | Populus trichocarpa | XP_002303803.1 | cytochrome P450 [Populus trichocarpa] | 4.0e-15 | 88% |
![]() |
---|
Fln status: Putative N-terminus
Fln database: coniferopsida.fasta
Fln subject: D5ACY1
Fln msg: Distance to subject end: 42 aas, atg_distance in limit (1-15): atg_distance = 9, W2: There is no M at the beginning, your sequence is shorter than subject: 34 - 85
Fln protein:
N
Protein Length:
35
Fln nts:
C
Fln Alignment:
GG46A6U02HMEEK___NDLRLAPFGAGRRVCPGKALGLATVNLWVAKLLH
D5ACY1_______________HDLRLAPFGSGRRVCPGKSLGLATVNLWVAKLLH
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain