|
||||||
|
UniGene Name: sp_v3.0_unigene71340
Length: 176 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene71340
C |
|
Ace file of the UniGene sp_v3.0_unigene71340
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Alcohol dehydrogenase (Fragment) n=1 Tax=Pinus banksiana RepID=Q43300_PINBN | - | - | 2.0e-17 | 97% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 82% |
| Sma3 | Alcohol dehydrogenase | - | - | 5.805e-18 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Alcohol dehydrogenase. | EC:1.1.1.1 | - | 4.795e-23 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glycolysis / Gluconeogenesis | 00010 | 4.795e-23 | % | |
| Sma3 | Fatty acid metabolism | 00071 | 4.795e-23 | % | |
| Sma3 | Glycine, serine and threonine metabolism | 00260 | 4.795e-23 | % | |
| Sma3 | Tyrosine metabolism | 00350 | 4.795e-23 | % | |
| Sma3 | Chloroalkane and chloroalkene degradation | 00625 | 4.795e-23 | % | |
| Sma3 | Naphthalene degradation | 00626 | 4.795e-23 | % | |
| Sma3 | Retinol metabolism | 00830 | 4.795e-23 | % | |
| Sma3 | Metabolism of xenobiotics by cytochrome P450 | 00980 | 4.795e-23 | % | |
| Sma3 | Drug metabolism - cytochrome P450 | 00982 | 4.795e-23 | % | |
| Sma3 | Metabolic pathways | 01100 | 4.795e-23 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 4.795e-23 | % | |
| Sma3 | S-(hydroxymethyl)glutathione dehydrogenase. | EC:1.1.1.284 | - | 4.307e-06 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Methane metabolism | 00680 | 4.307e-06 | % |
| Source | Gene names |
|---|---|
| Sma3 | ADH; ADH1; ADH2; ADH3; Adh; Adh2; Adh3; AdhC1; AdhC2; AdhC3; AdhC4; AdhC5; AdhC7; At1g77120; F22K20.19; GSVIVT00014300001; GSVIVT00034830001; GSVIVT00034832001; LOC_Os11g10520; OA_CBa016E12-6; OA_CBa016E12-7; OG_ABa077F15_032P05-4; OO_Ba194G19-3; OP_Ba004 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
| Sma3 | alcohol dehydrogenase (NAD) activity | GO:0004022 | Molecular Function | 0.0 | - |
| Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
| Sma3 | response to hypoxia | GO:0001666 | Biological Process | 0.0 | - |
| Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
| Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
| Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Alcohol dehydrogenase superfamily, zinc-type | IPR002085 | - | 0.0 | - |
| Sma3 | Alcohol dehydrogenase, zinc-type, conserved site | IPR002328 | - | 0.0 | - |
| Sma3 | Alcohol dehydrogenase, C-terminal | IPR013149 | - | 0.0 | - |
| Sma3 | Alcohol dehydrogenase GroES-like | IPR013154 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G77120.1 | ADH1, ADH, ATADH, ATADH1 alcohol dehydrogenase 1 chr1:28975509-28977216 FORWARD LENGTH=379 | 1.0e-14 | 69% |
| RefSeq | Arabidopsis thaliana | NP_177837.1 | alcohol dehydrogenase class-P [Arabidopsis thaliana] | 1.0e-14 | 69% |
| RefSeq | Populus trichocarpa | XP_002328463.1 | predicted protein, partial [Populus trichocarpa] | 3.0e-16 | 71% |
| Full-Lengther Next Prediction |
|---|
Fln status: C-terminus
Fln database: coniferopsida.fasta
Fln subject: A9NQ91
Fln msg: your sequence is shorter than subject: 54 - 103
Fln protein:
V
Protein Length:
55
Fln nts:
C
Fln Alignment:
GG46A6U02IGAPB___EMYLAKKIELEKFITHEVSFADINKSFDYMLKGESLRCIINLIGN
A9NQ91_______________ELYLDKKLELEKFITHEVSFANINKAFDYMIKGESLRCVINVIGN
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
