|
||||||
|
UniGene Name: sp_v3.0_unigene71300
Length: 235 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene71300
C |
|
Ace file of the UniGene sp_v3.0_unigene71300
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | MAP kinase-like protein [Gossypium hirsutum] | - | - | 1.0e-25 | 68% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 86% |
| Sma3 | With no lysine kinase | - | - | 1.96182e-44 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Non-specific serine/threonine protein kinase. | EC:2.7.11.1 | - | 4.345e-34 | - |
| Sma3 | Mitogen-activated protein kinase kinase kinase. | EC:2.7.11.25 | - | 1.889e-17 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT1G49160; At1g49160; At1g64630; At3g04910; At3g18750; At3g22420; At3g48260; At3g51630; At5g28080; At5g41990; At5g55560; At5g58350; CHLREDRAFT_162667; CHLREDRAFT_206084; FLR; GSVIVT00000541001; GSVIVT00006916001; GSVIVT00008654001; GSVIVT00015972001; GSVI |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | circadian rhythm | GO:0007623 | Biological Process | 0.0 | - |
| Sma3 | protein autophosphorylation | GO:0046777 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | Peptidase aspartic, active site | IPR001969 | - | 0.0 | - |
| Sma3 | Tyrosine-protein kinase, active site | IPR008266 | - | 0.0 | - |
| Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | IPR017442 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G55560.1 | Protein kinase superfamily protein chr5:22506477-22507757 REVERSE LENGTH=314 | 3.0e-32 | 68% |
| RefSeq | Arabidopsis thaliana | NP_200367.2 | putative serine/threonine-protein kinase WNK11 [Arabidopsis thaliana] | 4.0e-32 | 68% |
| RefSeq | Populus trichocarpa | XP_002321177.1 | predicted protein [Populus trichocarpa] | 2.0e-33 | 71% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NQP1
Fln msg: Distance to subject end: 84 aas, your sequence is shorter than subject: 78 - 290
Fln protein:
V
Protein Length:
79
Fln nts:
C
Fln Alignment:
GG46A6U02J4KX3___LAVTQGLHYLHNHEPCVIHRDLNCSNIFVNGNSGVLKIGDLGLATTLVNDRCAHTVLGTPEFMAPELYEEEYNEL
A9NQP1_______________LQILGGLHYLHNHEPCIIHRDLNCSNIFVNGNSGVLKIGDLGLATTLGNDHAAHTVLGTPEFMAPELYDEDYNEL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
