|
||||||
|
UniGene Name: sp_v3.0_unigene71262
Length: 194 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene71262
C |
|
Ace file of the UniGene sp_v3.0_unigene71262
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Transcription factor MYB3 n=2 Tax=Fagopyrum tataricum RepID=F5BUC7_FAGTA | - | - | 6.0e-23 | 88% |
| FL-Next | tr=R2R3-MYB transcription factor MYB5; Picea glauca (White spruce) (Pinus glauca). | - | - | 0.0 | 86% |
| Sma3 | MYB1 | - | - | 2.736e-11 | - |
| Source | Gene names |
|---|---|
| Sma3 | 46C02.19; At1g22640; At1g35515; At2g16720; At4g09460; At4g34990; At4g38620; C; C1; DcMYB3-1; DcMYB3-2; DcMYB5; F12K8.1; F20M13.180; F5E19_110; FcMYB251; GSVIVT00006679001; GSVIVT00016469001; GSVIVT00017797001; GSVIVT00017798001; GSVIVT00022367001; GSVIVT0 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | cysteine-type peptidase activity | GO:0008234 | Molecular Function | 0.0 | - |
| Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
| Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
| Sma3 | cold acclimation | GO:0009631 | Biological Process | 0.0 | - |
| Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
| Sma3 | response to ethylene stimulus | GO:0009723 | Biological Process | 0.0 | - |
| Sma3 | response to auxin stimulus | GO:0009733 | Biological Process | 0.0 | - |
| Sma3 | response to abscisic acid stimulus | GO:0009737 | Biological Process | 0.0 | - |
| Sma3 | response to gibberellin stimulus | GO:0009739 | Biological Process | 0.0 | - |
| Sma3 | response to salicylic acid stimulus | GO:0009751 | Biological Process | 0.0 | - |
| Sma3 | response to jasmonic acid stimulus | GO:0009753 | Biological Process | 0.0 | - |
| Sma3 | GO:0045449 | Biological Process | 0.0 | - | |
| Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | SANT/Myb domain | IPR001005 | - | 0.0 | - |
| Sma3 | Peptidase C48, SUMO/Sentrin/Ubl1 | IPR003653 | - | 0.0 | - |
| Sma3 | Transposon, En/Spm-like | IPR004242 | - | 0.0 | - |
| Sma3 | IPR012287 | - | 0.0 | - | |
| Sma3 | IPR014778 | - | 0.0 | - | |
| Sma3 | Myb transcription factor | IPR015495 | - | 0.0 | - |
| Sma3 | Myb-like domain | IPR017877 | - | 0.0 | - |
| Sma3 | Myb domain, DNA-binding | IPR017930 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G38620.1 | ATMYB4, MYB4 myb domain protein 4 chr4:18053866-18054876 FORWARD LENGTH=282 | 6.0e-30 | 86% |
| RefSeq | Arabidopsis thaliana | NP_195574.1 | transcription repressor MYB4 [Arabidopsis thaliana] | 8.0e-30 | 86% |
| RefSeq | Populus trichocarpa | XP_002306180.1 | predicted protein [Populus trichocarpa] | 6.0e-30 | 86% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A5JYE9
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 161 aas, your sequence is shorter than subject: 64 - 257
Fln protein:
S
Protein Length:
65
Fln nts:
C
Fln Alignment:
GG46A6U02I8H0D___WLSLMFLTAGLLRCWKSCRLRWMNYLRPDLKRGNFSEEEDELIIKLHSLLGNKWSLIAGRL
A5JYE9_______________WRSLP-KAAGLMRCGKSCRLRWINYLRPDLKRGNFSEEEDELIIKLHSLLGNKWSLIAGRL
| SSRs (tot: 1) |
|---|
| Start position | End position | Sequence | Length |
|---|---|---|---|
| 119 | 130 | AGA AGA AGA AGA | 12 |
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
