|
||||||
|
UniGene Name: sp_v3.0_unigene71154
Length: 228 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene71154
C |
|
Ace file of the UniGene sp_v3.0_unigene71154
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Chaperone clpb, putative n=1 Tax=Ricinus communis RepID=B9RNX1_RICCO | - | - | 2.0e-25 | 85% |
| FL-Next | sp=Chaperone protein ClpB3, mitochondrial; Oryza sativa subsp. japonica (Rice). | - | - | 0.0 | 82% |
| Sma3 | Chaperone, Hsp100 family, clpb-type | - | - | 2.689e-08 | - |
| Source | Gene names |
|---|---|
| Sma3 | At2g25140; At5g15450; CHLREDRAFT_195422; CLPB1; CLPB3; ClpN; GSVIVT00021042001; GSVIVT00032702001; LOC_Os03g31300; Lehsp100/ClpB; MICPUCDRAFT_56397; MICPUN_57068; OSJNBa0020H02.1; OSJNBa0083F15.25; OSTLU_24612; Os02g0181900; Os03g0426900; OsI_06111; OsI_1 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | peptidase activity | GO:0008233 | Molecular Function | 0.0 | - |
| Sma3 | nucleoside-triphosphatase activity | GO:0017111 | Molecular Function | 0.0 | - |
| Sma3 | response to stress | GO:0006950 | Biological Process | 0.0 | - |
| Sma3 | response to heat | GO:0009408 | Biological Process | 0.0 | - |
| Sma3 | chloroplast organization | GO:0009658 | Biological Process | 0.0 | - |
| Sma3 | protein metabolic process | GO:0019538 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Chaperonin ClpA/B | IPR001270 | - | 0.0 | - |
| Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
| Sma3 | ATPase, AAA-type, core | IPR003959 | - | 0.0 | - |
| Sma3 | Clp, N-terminal | IPR004176 | - | 0.0 | - |
| Sma3 | ATPase, AAA-2 | IPR013093 | - | 0.0 | - |
| Sma3 | Chaperonin ClpB | IPR017730 | - | 0.0 | - |
| Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
| Sma3 | Chaperonin ClpA/B, conserved site | IPR018368 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G25140.1 | HSP98.7, CLPB-M, CLPB4 casein lytic proteinase B4 chr2:10697877-10701998 REVERSE LENGTH=964 | 3.0e-29 | 77% |
| RefSeq | Arabidopsis thaliana | NP_565586.1 | casein lytic proteinase B4 [Arabidopsis thaliana] | 4.0e-29 | 77% |
| RefSeq | Populus trichocarpa | XP_002308700.1 | predicted protein, partial [Populus trichocarpa] | 2.0e-30 | 82% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q0E3C8
Fln msg: Distance to subject end: 341 aas, your sequence is shorter than subject: 76 - 983
Fln protein:
R
Protein Length:
77
Fln nts:
C
Fln Alignment:
GG46A6U02JSE8Z___RVNLEMQAAEREYDLNRAAELKYGTLISLQRQLEEAEKKLAEYREIGKSMLREEVTEIDIAEIVSKWT
Q0E3C8_______________RVNLEIEAAEREYDLNRAAELKYGTLLSLQKQLEEAENKLMEFQQSGKSMLREEVTDVDIAEIVSKWT
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
