|
||||||
|
UniGene Name: sp_v3.0_unigene71109
Length: 177 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene71109
C |
|
Ace file of the UniGene sp_v3.0_unigene71109
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic; AltName: Full=Beta-ketoacyl-ACP synthase I; Short=KAS I; Flags: Precursor gb|AAA32968.1| beta-ketoacyl-ACP synthase I [Hordeum vulgare] dbj|BAJ88844.1| predicted protein [Hordeum vu | - | - | 5.0e-13 | 79% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 95% |
| Sma3 | Beta-ketoacyl-ACP synthase I | - | - | 6.569e-16 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Beta-ketoacyl-acyl-carrier-protein synthase I. | EC:2.3.1.41 | - | 8.926e-16 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Fatty acid biosynthesis | 00061 | 8.926e-16 | % | |
| Sma3 | Metabolic pathways | 01100 | 8.926e-16 | % |
| Source | Gene names |
|---|---|
| Sma3 | At5g46290; CHLREDRAFT_181037; GSVIVT00003432001; KAS I; KAS1; KAS12; KASI; Kas; MICPUCDRAFT_49639; MPL12.7; OSIGBa0140O07.8; OSJNBa0027P08.14; OSTLU_35878; Os04g0445700; Os06g0196600; OsI_16057; OsI_22012; OsJ_14945; OsJ_20447; Ot02g03940; P0528E04.26; PH |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
| Sma3 | 3-oxoacyl-[acyl-carrier-protein] synthase activity | GO:0004315 | Molecular Function | 0.0 | - |
| Sma3 | transferase activity, transferring acyl groups other than amino-acyl groups | GO:0016747 | Molecular Function | 0.0 | - |
| Sma3 | fatty acid biosynthetic process | GO:0006633 | Biological Process | 0.0 | - |
| Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
| Sma3 | biosynthetic process | GO:0009058 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Beta-ketoacyl synthase | IPR000794 | - | 0.0 | - |
| Sma3 | Beta-ketoacyl synthase, N-terminal | IPR014030 | - | 0.0 | - |
| Sma3 | Beta-ketoacyl synthase, C-terminal | IPR014031 | - | 0.0 | - |
| Sma3 | Thiolase-like, subgroup | IPR016038 | - | 0.0 | - |
| Sma3 | 3-oxoacyl-[acyl-carrier-protein] synthase 2 | IPR017568 | - | 0.0 | - |
| Sma3 | Beta-ketoacyl synthase, active site | IPR018201 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G46290.3 | KASI 3-ketoacyl-acyl carrier protein synthase I chr5:18774439-18776629 REVERSE LENGTH=489 | 1.0e-15 | 75% |
| RefSeq | Arabidopsis thaliana | NP_001190479.1 | 3-oxoacyl-[acyl-carrier-protein] synthase I [Arabidopsis thaliana] | 1.0e-15 | 75% |
| RefSeq | Populus trichocarpa | XP_002303661.1 | predicted protein [Populus trichocarpa] | 2.0e-19 | 84% |
| Full-Lengther Next Prediction |
|---|
Fln status: C-terminus
Fln database: coniferopsida.fasta
Fln subject: D5ABC3
Fln msg: your sequence is shorter than subject: 53 - 481
Fln protein:
R
Protein Length:
54
Fln nts:
C
Fln Alignment:
GG46A6U02ILCLU___NTEPDVTIDTVPNIKKQHEVHVGISNSFGFGGHNSVVAFAPFNP
D5ABC3_______________NTEPDVTIDTVPNVKKQHEVHVGISNSFGFGGHNSVVTFAPFNP
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
