UniGene Name: sp_v3.0_unigene71078
Length: 203 nt
![]() |
---|
>sp_v3.0_unigene71078
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Transferase, transferring glycosyl groups, putative n=1 Tax=Ricinus communis RepID=B9RNP7_RICCO | - | - | 4.0e-10 | 62% |
FL-Next | sp=Probable xyloglucan glycosyltransferase 7; Oryza sativa subsp. japonica (Rice). | - | - | 0.0 | 58% |
Sma3 | Transferase, transferring glycosyl groups, putative | - | - | 6.48e-09 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Transferases, Glycosyltransferases, Hexosyltransferases. | EC:2.4.1.- | - | 1.813e-07 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Starch and sucrose metabolism | 00500 | 7.144e-06 | % |
Source | Gene names |
---|---|
Sma3 | CSLC1; CSLC2; CSLC7; GSVIVT00008341001; GSVIVT00014999001; GSVIVT00020790001; GSVIVT00025276001; LOC_Os01g56130; LOC_Os05g43530; OJ1005_B11.7; OSJNBb0053G03.13; Os01g0766900; Os05g0510800; OsI_030406; OsI_03873; OsI_20583; OsJ_03581; OsJ_19159; OsJ_29438; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Golgi membrane | GO:0000139 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | transferase activity | GO:0016740 | Molecular Function | 0.0 | - |
Sma3 | transferase activity, transferring glycosyl groups | GO:0016757 | Molecular Function | 0.0 | - |
Sma3 | cellular cell wall organization | GO:0007047 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Glycosyl transferase, family 2 | IPR001173 | - | 0.0 | - |
Sma3 | Inorganic pyrophosphatase | IPR008162 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G31590.1 | ATCSLC05, CSLC05, ATCSLC5, CSLC5 Cellulose-synthase-like C5 chr4:15309889-15312336 REVERSE LENGTH=692 | 3.0e-11 | 57% |
RefSeq | Arabidopsis thaliana | NP_194887.1 | putative xyloglucan glycosyltransferase 5 [Arabidopsis thaliana] | 4.0e-11 | 57% |
RefSeq | Populus trichocarpa | XP_002330753.1 | predicted protein, partial [Populus trichocarpa] | 2.0e-14 | 60% |
![]() |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q6L538
Fln msg: Distance to subject end: 22 aas, your sequence is shorter than subject: 67 - 688
Fln protein:
R
Protein Length:
68
Fln nts:
C
Fln Alignment:
GG46A6U02FMCJY___HPKYHRGFSESALDVLNKLSERQQKQPSKKKANRLY*KELALAFLILT-SARSLLSAQGIHF
Q6L538_______________HSKQQRVGSAPNLDALTKEESNPKKDSKKKKHNRIYRKELALSFLLLTAAARSLLSAQGIHF
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain