UniGene Name: sp_v3.0_unigene70988
Length: 187 nt
![]() |
---|
>sp_v3.0_unigene70988
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Ferritin (Fragment) n=3 Tax=Pseudotsuga RepID=C6F952_PSEMZ | - | - | 7.0e-21 | 92% |
FL-Next | sp=Ferritin; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 84% |
Sma3 | Ferritin | - | - | 0.0 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Ferroxidase. | EC:1.16.3.1 | - | 0.0 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Porphyrin and chlorophyll metabolism | 00860 | 0.0 | % |
Source | Gene names |
---|---|
Sma3 | AT3g56090/F18O21_50; At2g40300; At3g11050; At3g56090; At5g01600; CHLREDRAFT_206372; F11B9.26; F18O21_50; F7A7.120; F9F8.13; FER; FER1; FER2; FER3; FER4; FTN; Fer1; Fer2; Fer3; Fer4; GSVIVT00001284001; GSVIVT00024034001; GSVIVT00029357001; LOC_Os11g01530; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | chloroplast thylakoid membrane | GO:0009535 | Cellular Component | 0.0 | - |
Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | ferroxidase activity | GO:0004322 | Molecular Function | 0.0 | - |
Sma3 | ferric iron binding | GO:0008199 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
Sma3 | response to reactive oxygen species | GO:0000302 | Biological Process | 0.0 | - |
Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
Sma3 | iron ion transport | GO:0006826 | Biological Process | 0.0 | - |
Sma3 | cellular iron ion homeostasis | GO:0006879 | Biological Process | 0.0 | - |
Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
Sma3 | response to cold | GO:0009409 | Biological Process | 0.0 | - |
Sma3 | response to bacterium | GO:0009617 | Biological Process | 0.0 | - |
Sma3 | response to abscisic acid stimulus | GO:0009737 | Biological Process | 0.0 | - |
Sma3 | flower development | GO:0009908 | Biological Process | 0.0 | - |
Sma3 | response to iron ion | GO:0010039 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Sma3 | photosynthesis | GO:0015979 | Biological Process | 0.0 | - |
Sma3 | response to hydrogen peroxide | GO:0042542 | Biological Process | 0.0 | - |
Sma3 | leaf development | GO:0048366 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | G-patch domain | IPR000467 | - | 0.0 | - |
Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
Sma3 | Ferritin | IPR001519 | - | 0.0 | - |
Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
Sma3 | Retrotransposon gag protein | IPR005162 | - | 0.0 | - |
Sma3 | Ferritin/DPS protein domain | IPR008331 | - | 0.0 | - |
Sma3 | Ferritin- like diiron domain | IPR009040 | - | 0.0 | - |
Sma3 | Ferritin-related | IPR012347 | - | 0.0 | - |
Sma3 | Ferritin, conserved site | IPR014034 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G11050.1 | ATFER2, FER2 ferritin 2 chr3:3463651-3465294 FORWARD LENGTH=253 | 2.0e-21 | 71% |
RefSeq | Arabidopsis thaliana | NP_187716.1 | ferritin 2 [Arabidopsis thaliana] | 3.0e-21 | 71% |
RefSeq | Populus trichocarpa | XP_002309156.1 | predicted protein [Populus trichocarpa] | 7.0e-23 | 73% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: C0PRI0
Fln msg: Distance to subject end: 22 aas, your sequence is shorter than subject: 62 - 289
Fln protein:
R
Protein Length:
63
Fln nts:
C
Fln Alignment:
GG46A6U02FF5JM___VAQEANDGQMTDFIEGEFLSQQVETIKKVSEYVSQLRRIGKGHAVWHFDQMLL
C0PRI0_______________VAQEANDGQMTDFIEGNFLTDQVQAIKKVSEYASQLRRIGQGHGVWHFDQMLL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain