UniGene Name: sp_v3.0_unigene70868
Length: 214 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene70868
C |
Ace file of the UniGene sp_v3.0_unigene70868
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Endoglucanase 8 n=2 Tax=Arabidopsis RepID=GUN8_ARATH | - | - | 8.0e-22 | 74% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 80% |
| Sma3 | Endo-1,4-beta-glucanase | - | - | 7.498e-37 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Cellulase. | EC:3.2.1.4 | - | 0.0 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Starch and sucrose metabolism | 00500 | 0.0 | % |
| Source | Gene names |
|---|---|
| Sma3 | 6J23.18; Al-cel1; At1g02800; At1g22880; At1g23210; At1g48930; At1g64390; At1g70710; At1g71380; At2g32990; At2g44540; At2g44550; At2g44560; At2g44570; At3g43860; At4g02290; At4g09740; At4g11050; At4g23560; At4g38990; At4g39000; At4g39010; B1011A07.26; B133 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | extracellular region | GO:0005576 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | hydrolase activity, hydrolyzing O-glycosyl compounds | GO:0004553 | Molecular Function | 0.0 | - |
| Sma3 | cellulase activity | GO:0008810 | Molecular Function | 0.0 | - |
| Sma3 | carbohydrate binding | GO:0030246 | Molecular Function | 0.0 | - |
| Sma3 | carbohydrate metabolic process | GO:0005975 | Biological Process | 0.0 | - |
| Sma3 | cellular cell wall organization | GO:0007047 | Biological Process | 0.0 | - |
| Sma3 | pattern specification process | GO:0007389 | Biological Process | 0.0 | - |
| Sma3 | response to nematode | GO:0009624 | Biological Process | 0.0 | - |
| Sma3 | fruit ripening | GO:0009835 | Biological Process | 0.0 | - |
| Sma3 | cellulose catabolic process | GO:0030245 | Biological Process | 0.0 | - |
| Sma3 | cell wall modification involved in multidimensional cell growth | GO:0042547 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glycoside hydrolase, family 9 | IPR001701 | - | 0.0 | - |
| Sma3 | Six-hairpin glycosidase | IPR012341 | - | 0.0 | - |
| Sma3 | Glycoside hydrolase, family 9, active site | IPR018221 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G70710.1 | ATGH9B1, CEL1, GH9B1 glycosyl hydrolase 9B1 chr1:26659356-26662962 REVERSE LENGTH=492 | 2.0e-28 | 74% |
| RefSeq | Arabidopsis thaliana | NP_177228.1 | endoglucanase 8 [Arabidopsis thaliana] | 2.0e-28 | 74% |
| RefSeq | Populus trichocarpa | XP_002321834.1 | predicted protein [Populus trichocarpa] | 8.0e-27 | 75% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NUH0
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 408 aas, your sequence is shorter than subject: 70 - 514
Fln protein:
S
Protein Length:
71
Fln nts:
C
Fln Alignment:
GG46A6U02JM0EC___HDYRDALSKSILFFEGQRSGKLPANQRIKWRKDSALRDGSAANVDLVGGYYDAGDN
A9NUH0_______________HDYRDALTKSILFYEGQRSGKLPLNQRMRWRADSALSDGAAEHVDLTGGYYDAGDN

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta