UniGene Name: sp_v3.0_unigene70810
Length: 232 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
![]() |
---|
>sp_v3.0_unigene70810
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Gag-pol polyprotein (Fragment) n=1 Tax=Bouteloua hirsuta subsp. pectinata RepID=D2Y6R6_9POAL | - | - | 5.0e-16 | 57% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 43% |
Sma3 | Putative gag-pol polyprotein | - | - | 1.685e-09 | - |
Source | Gene names |
---|---|
Sma3 | LOC_Os03g35326; LOC_Os10g16560; LOC_Os10g20440; OSJNAa0082N11.12; OSJNBa0003M24.1; OSJNBa0034E23.18; OSJNBa0038J12.13; OSJNBa0045C13.1; OSJNBa0095C12.16; OSJNBb0047B19.6; OSJNBb0052C09.15; VITISV_003380; VITISV_004909; VITISV_007952; VITISV_008198; VITISV |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chromatin | GO:0000785 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | beta-galactosidase complex | GO:0009341 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | chromatin binding | GO:0003682 | Molecular Function | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
Sma3 | beta-galactosidase activity | GO:0004565 | Molecular Function | 0.0 | - |
Sma3 | aminoacyl-tRNA ligase activity | GO:0004812 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | cysteine-type peptidase activity | GO:0008234 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | carbohydrate metabolic process | GO:0005975 | Biological Process | 0.0 | - |
Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
Sma3 | chromatin assembly or disassembly | GO:0006333 | Biological Process | 0.0 | - |
Sma3 | tRNA aminoacylation for protein translation | GO:0006418 | Biological Process | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
Sma3 | Chromo domain/shadow | IPR000953 | - | 0.0 | - |
Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
Sma3 | Glycoside hydrolase, family 35 | IPR001944 | - | 0.0 | - |
Sma3 | Short-chain dehydrogenase/reductase SDR | IPR002198 | - | 0.0 | - |
Sma3 | Aminoacyl-tRNA synthetase, class Ic | IPR002305 | - | 0.0 | - |
Sma3 | Peptidase C48, SUMO/Sentrin/Ubl1 | IPR003653 | - | 0.0 | - |
Sma3 | Auxin efflux carrier | IPR004776 | - | 0.0 | - |
Sma3 | Retrotransposon gag protein | IPR005162 | - | 0.0 | - |
Sma3 | IPR013084 | - | 0.0 | - | |
Sma3 | Zinc finger, H2C2-type, histone UAS binding | IPR015416 | - | 0.0 | - |
![]() |
---|
Fln status: Putative Complete
Fln database: coniferopsida.fasta
Fln subject: D5ABB2
Fln msg: atg_distance in limit (1-15): atg_distance = 13, No stop codon before M and low homology subject,
Fln protein:
M
Protein Length:
72
Fln nts:
A
Fln Alignment:
GG46A6U02HRXAF___MQTDVKRFSEKCRICQHAKGRSQNTRLY*PLPIRDRPWDAVNMDFILGLPKTQRGNDSIYVVVD
D5ABB2_______________LRHDVSKYIRSCSACSIAKPAIKKQGLYTPLPTLDRPWESISMDYMSGLPSTKHGNDYVFVVVD
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain