SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene70808

Length: 380 nt

UniGene Fasta

>sp_v3.0_unigene70808
CGTCGTGACCTTGGCTGTCACTCAAACACAGACAATCATTTGGAACGGACCAATGGGTGTCTTTGAATTTGACAAGTTTGCAGTAGGAACTGAGTCTATTGCAAAGAAGTTGGCCGAGCTTAGCAAAAAGGGTGTTACAACTATTATTGGAGGCGGAGACTCCGTTGCGGCTGTTGAGAAGGTGGGAGTGGCTGATGTTATGAGCCACATCTCAACTGGTGGTGGTGCCAGCTTGGAGTTGTTGGAAGGAAAGGAGCTGCCTGGAGTCGTTGCACTTGATGAAGGTGTCATGACGAGGTCGGTGACCGTATGAGGCTAAGCTTCATTTTGTTGCATCTCAATTCCTTTCATGTACCGTTCTAAACCTGCCATGTTGTCCT

Ace file of the UniGene sp_v3.0_unigene70808

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	Identity
AutoFact	Phosphoglycerate kinase, chloroplastic n=13 Tax=Triticeae RepID=PGKH_WHEAT	-	-	96%
FL-Next	sp=Phosphoglycerate kinase; Pinus pinaster (Maritime pine).	-	-	85%
Sma3	Phosphoglycerate kinase	-	-	-

Source	ECs	Term	Type	e value	Identity
Sma3	Phosphoglycerate kinase.	EC:2.7.2.3	-	0.0	-

Source	KEGGs	Term	Identity
Sma3	Glycolysis / Gluconeogenesis	00010	%
Sma3	Carbon fixation in photosynthetic organisms	00710	%
Sma3	Biosynthesis of phenylpropanoids	01061	%
Sma3	Biosynthesis of terpenoids and steroids	01062	%
Sma3	Biosynthesis of alkaloids derived from shikimate pathway	01063	%
Sma3	Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid	01064	%
Sma3	Biosynthesis of alkaloids derived from histidine and purine	01065	%
Sma3	Biosynthesis of alkaloids derived from terpenoid and polyketide	01066	%
Sma3	Biosynthesis of plant hormones	01070	%
Sma3	Metabolic pathways	01100	%
Sma3	Biosynthesis of secondary metabolites	01110	%

Source	Gene names
Sma3	AT1G79550; AT3G12780; At1g56190; At1g79550; At1g79550/T8K14.3; At3g12780; At3g12810; At3g12810/MBK21.17; CHLREDRAFT_132210; CHLREDRAFT_196383; CT114; GSVIVT00035675001; GSVIVT00035677001; MA4_106O17.68; MA4_112I10.62; MICPUCDRAFT_17660; MICPUN_104767; OJ1

Source	GOs	Term	Type	Identity
Sma3	cell wall	GO:0005618	Cellular Component	-
Sma3	nucleus	GO:0005634	Cellular Component	-
Sma3	cytoplasm	GO:0005737	Cellular Component	-
Sma3	mitochondrion	GO:0005739	Cellular Component	-
Sma3	cytosol	GO:0005829	Cellular Component	-
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	chloroplast	GO:0009507	Cellular Component	-
Sma3	chloroplast stroma	GO:0009570	Cellular Component	-
Sma3	thylakoid	GO:0009579	Cellular Component	-
Sma3	chloroplast envelope	GO:0009941	Cellular Component	-
Sma3	membrane	GO:0016020	Cellular Component	-
Sma3	apoplast	GO:0048046	Cellular Component	-
Sma3	phosphoglycerate kinase activity	GO:0004618	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	glycolysis	GO:0006096	Biological Process	-
Sma3	response to cold	GO:0009409	Biological Process	-
Sma3	reductive pentose-phosphate cycle	GO:0019253	Biological Process	-
Sma3	response to cadmium ion	GO:0046686	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Peptidase, cysteine peptidase active site	IPR000169	-	-
Sma3	Phosphoglycerate kinase	IPR001576	-	-
Sma3	Phosphoglycerate kinase, N-terminal	IPR015824	-	-
Sma3	Phosphoglycerate kinase, C-terminal	IPR015901	-	-
Sma3	Phosphoglycerate kinase, conserved site	IPR015911	-	-
Sma3	Aldehyde dehydrogenase, conserved site	IPR016160	-	-
Sma3	WD40 repeat, conserved site	IPR019775	-	-

Source	Species	ID	Description	Identity
ATG	Arabidoptis thaliana	AT1G56190.1	Phosphoglycerate kinase family protein chr1:21028403-21030454 FORWARD LENGTH=478	87%
RefSeq	Arabidopsis thaliana	NP_001117503.1	phosphoglycerate kinase [Arabidopsis thaliana]	87%
RefSeq	Populus trichocarpa	XP_002315066.1	predicted protein [Populus trichocarpa]	92%

Full-Lengther Next Prediction

Fln status: C-terminus

Fln database: coniferopsida.fasta

Fln subject: F4MKM1

Fln msg: your sequence is shorter than subject: 104 - 507

Fln protein: VVTLAVTQTQTIIWNGPMGVFEFDKFAVGTESIAKKLAELSKKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVVALDEGVMTRSVTV*

Protein Length: 105

Fln nts: CGTCGTGACCTTGGCTGTCACTCAAACACAGACAATCATTTGGAACGGACCAATGGGTGTCTTTGAATTTGACAAGTTTGCAGTAGGAACTGAGTCTATTGCAAAGAAGTTGGCCGAGCTTAGCAAAAAGGGTGTTACAACTATTATTGGAGGCGGAGACTCCGTTGCGGCTGTTGAGAAGGTGGGAGTGGCTGATGTTATGAGCCACATCTCAACTGGTGGTGGTGCCAGCTTGGAGTTGTTGGAAGGAAAGGAGCTGCCTGGAGTCGTTGCACTTGATGAAGGTGTCATGACGAGGTCGGTGACCGTATGA___GGCTAAGCTTCATTTTGTTGCATCTCAATTCCTTTCATGTACCGTTCTAAACCTGCCATGTTGTCCT

Fln Alignment:

GG46A6U02FUYN1___AVTQTQTIIWNGPMGVFEFDKFAVGTESIAKKLAELSKKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVVALDEGV
F4MKM1_______________ALDTTKTVIWNGPMGVFEFDKFAAGTESIAKKLAELSGKGVITIIGGGDSVAAVEKVGVAEKMSHISTGGGASLELLEGKTLPGVLALDEAV

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain