UniGene Name: sp_v3.0_unigene70759
Length: 231 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene70759
C |
Ace file of the UniGene sp_v3.0_unigene70759
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Thioredoxin reductase n=2 Tax=Picea sitchensis RepID=A9NXV4_PICSI | - | - | 6.0e-15 | 88% |
| FL-Next | sp=Thioredoxin reductase; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 91% |
| Sma3 | Thioredoxin reductase | - | - | 0.0 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Thioredoxin-disulfide reductase. | EC:1.8.1.9 | - | 0.0 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Pyrimidine metabolism | 00240 | 0.0 | % | |
| Sma3 | Selenocompound metabolism | 00450 | 0.0 | % |
| Source | Gene names |
|---|---|
| Sma3 | At2g17420; At2g41680; At2g41680/T32G6.20; At4g35460; CHLREDRAFT_132865; CHLREDRAFT_196120; CHLREDRAFT_78928; F5J6.18; GSVIVT00006001001; GSVIVT00025615001; NTR1; NTR2; NTR3; NTRC; NTRC1; OJ1479_B12.9; OSJNBb0039F24.13; Os02g0713400; Os06g0327300; Os07g065 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | mitochondrial matrix | GO:0005759 | Cellular Component | 0.0 | - |
| Sma3 | cytosol | GO:0005829 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
| Sma3 | thioredoxin-disulfide reductase activity | GO:0004791 | Molecular Function | 0.0 | - |
| Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
| Sma3 | flavin adenine dinucleotide binding | GO:0050660 | Molecular Function | 0.0 | - |
| Sma3 | pollen germination | GO:0009846 | Biological Process | 0.0 | - |
| Sma3 | cell growth | GO:0016049 | Biological Process | 0.0 | - |
| Sma3 | removal of superoxide radicals | GO:0019430 | Biological Process | 0.0 | - |
| Sma3 | hydrogen peroxide catabolic process | GO:0042744 | Biological Process | 0.0 | - |
| Sma3 | thioredoxin biosynthetic process | GO:0042964 | Biological Process | 0.0 | - |
| Sma3 | cell redox homeostasis | GO:0045454 | Biological Process | 0.0 | - |
| Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
| Sma3 | seed development | GO:0048316 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Pyridine nucleotide-disulphide oxidoreductase, class-II | IPR000103 | - | 0.0 | - |
| Sma3 | Pyridine nucleotide-disulphide oxidoreductase, NAD-binding domain | IPR001327 | - | 0.0 | - |
| Sma3 | Thioredoxin reductase | IPR005982 | - | 0.0 | - |
| Sma3 | Pyridine nucleotide-disulphide oxidoreductase, class-II, active site | IPR008255 | - | 0.0 | - |
| Sma3 | IPR012335 | - | 0.0 | - | |
| Sma3 | FAD-dependent pyridine nucleotide-disulphide oxidoreductase | IPR013027 | - | 0.0 | - |
| Sma3 | Thioredoxin domain | IPR013766 | - | 0.0 | - |
| Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
| Sma3 | IPR017909 | - | 0.0 | - | |
| Sma3 | IPR017936 | - | 0.0 | - | |
| Sma3 | Thioredoxin, conserved site | IPR017937 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G17420.1 | NTRA, ATNTRA, NTR2 NADPH-dependent thioredoxin reductase A chr2:7564357-7566219 FORWARD LENGTH=378 | 1.0e-18 | 82% |
| RefSeq | Arabidopsis thaliana | NP_179334.4 | NADPH-dependent thioredoxin reductase A [Arabidopsis thaliana] | 2.0e-18 | 82% |
| RefSeq | Populus trichocarpa | XP_002298998.1 | predicted protein, partial [Populus trichocarpa] | 1.0e-19 | 82% |
Full-Lengther Next Prediction |
|---|
Fln status: C-terminus
Fln database: coniferopsida.fasta
Fln subject: A9NU83
Fln msg: your sequence is shorter than subject: 64 - 340
Fln protein:
V
Protein Length:
65
Fln nts:
C
Fln Alignment:
GG46A6U02JEIKJ___THIAGVFAAGDVQDKKWRQAITAAGTGCMAALEAEHFLQEIAVQE
A9NU83_______________TSIPGVFAAGDVQDKKWRQAITAAGTGCMAALEAEHFLQEIGAQE

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta