SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene70700

Length: 371 nt

This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense

UniGene Fasta (sense)

>sp_v3.0_unigene70700
AGAAGATGAGGAATGAAGTTGAGAAGTATGTGAAAAATTGTAAAGTTTGTCAGTATGCAAAAGGAAGAAGCCAAGACACAAGTTTGTATGTTCCATTACCTATTCTAGATAGACCTTGGGATATGGTAAGCATGGATTTTGTTTTGGTCTTACCAAAGACTGAAAGAGGAAATGATTAAATTTATGTTGTGGTTGACAGATTTCCAAAAATGGCACATTTTTTTCCACGTTATAAAACCAGTGATGCTACTCACATTTCCAGTCTGTTTTTTAAAGAGATTGTAAGATTACATGGGTTACCTAAGAGTATTGTTTCCGACAGAGACTCCAAATTTGTTGGACATTTTTGAGTGACAGCCAAGGTCACGACG

Ace file of the UniGene sp_v3.0_unigene70700 (antisense)

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Putative gag-pol polyprotein n=1 Tax=Oryza sativa Japonica Group RepID=Q6UUF6_ORYSJ	-	-	6.0e-36	60%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	49%
Sma3	Gag-Pol polyprotein	-	-	3.92e-11	-

Source	Gene names
Sma3	AT4g07850; At2g06190; F5K24.1; LOC_Os03g35326; LOC_Os10g16560; LOC_Os10g20440; OJ1122_B08.16; OSJNAa0082N11.12; OSJNBa0003M24.1; OSJNBa0022B03.13; OSJNBa0034E23.18; OSJNBa0038J12.13; OSJNBa0045C13.1; OSJNBa0053F13.6; OSJNBa0079I01.17; OSJNBa0095C12.16; OS

Source	GOs	Term	Type	Identity
Sma3	chromatin	GO:0000785	Cellular Component	-
Sma3	nucleus	GO:0005634	Cellular Component	-
Sma3	cytoplasm	GO:0005737	Cellular Component	-
Sma3	beta-galactosidase complex	GO:0009341	Cellular Component	-
Sma3	integral to membrane	GO:0016021	Cellular Component	-
Sma3	nucleic acid binding	GO:0003676	Molecular Function	-
Sma3	DNA binding	GO:0003677	Molecular Function	-
Sma3	chromatin binding	GO:0003682	Molecular Function	-
Sma3	RNA binding	GO:0003723	Molecular Function	-
Sma3	RNA-directed DNA polymerase activity	GO:0003964	Molecular Function	-
Sma3	aspartic-type endopeptidase activity	GO:0004190	Molecular Function	-
Sma3	beta-galactosidase activity	GO:0004565	Molecular Function	-
Sma3	aminoacyl-tRNA ligase activity	GO:0004812	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	cysteine-type peptidase activity	GO:0008234	Molecular Function	-
Sma3	zinc ion binding	GO:0008270	Molecular Function	-
Sma3	protein methyltransferase activity	GO:0008276	Molecular Function	-
Sma3	carbohydrate metabolic process	GO:0005975	Biological Process	-
Sma3	RNA-dependent DNA replication	GO:0006278	Biological Process	-
Sma3	chromatin assembly or disassembly	GO:0006333	Biological Process	-
Sma3	tRNA aminoacylation for protein translation	GO:0006418	Biological Process	-
Sma3	protein methylation	GO:0006479	Biological Process	-
Sma3	proteolysis	GO:0006508	Biological Process	-
Sma3	DNA integration	GO:0015074	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Reverse transcriptase	IPR000477	-	-
Sma3	Chromo domain/shadow	IPR000953	-	-
Sma3	Integrase, catalytic core	IPR001584	-	-
Sma3	Zinc finger, CCHC-type	IPR001878	-	-
Sma3	Glycoside hydrolase, family 35	IPR001944	-	-
Sma3	Peptidase aspartic, active site	IPR001969	-	-
Sma3	Short-chain dehydrogenase/reductase SDR	IPR002198	-	-
Sma3	Aminoacyl-tRNA synthetase, class Ic	IPR002305	-	-
Sma3	Peptidase C48, SUMO/Sentrin/Ubl1	IPR003653	-	-
Sma3	Transposase, MuDR, plant	IPR004332	-	-
Sma3	Auxin efflux carrier	IPR004776	-	-
Sma3	Retrotransposon gag protein	IPR005162	-	-
Sma3	Domain of unknown function DUF659	IPR007021	-	-
Sma3	Peptidase aspartic, catalytic	IPR009007	-	-
Sma3	Ribosomal L11 methyltransferase, PrmA	IPR010456	-	-
Sma3	EGF-like region, conserved site	IPR013032	-	-
Sma3		IPR013084	-	-
Sma3	Zinc finger, H2C2-type, histone UAS binding	IPR015416	-	-
Sma3	MULE transposase domain	IPR018289	-	-

Full-Lengther Next Prediction

Fln status: Complete

Fln database: coniferopsida.fasta

Fln subject: D5ABB2

Fln msg: atg_distance in limit (1-15): atg_distance = 12, your sequence is shorter than subject: 58 - 76

Fln protein: MRNEVEKYVKNCKVCQYAKGRSQDTSLYVPLPILDRPWDMVSMDFVLVLPKTERGND*

Protein Length: 59

Fln nts: AGAAG_-_ATGAGGAATGAAGTTGAGAAGTATGTGAAAAATTGTAAAGTTTGTCAGTATGCAAAAGGAAGAAGCCAAGACACAAGTTTGTATGTTCCATTACCTATTCTAGATAGACCTTGGGATATGGTAAGCATGGATTTTGTTTTGGTCTTACCAAAGACTGAAAGAGGAAATGATTAA___ATTTATGTTGTGGTTGACAGATTTCCAAAAATGGCACATTTTTTTCCACGTTATAAAACCAGTGATGCTACTCACATTTCCAGTCTGTTTTTTAAAGAGATTGTAAGATTACATGGGTTACCTAAGAGTATTGTTTCCGACAGAGACTCCAAATTTGTTGGACATTTTTGAGTGACAGCCAAGGTCACGACG

Fln Alignment:

GG46A6U02H84EB___KMRNEVEKYVKNCKVCQYAKGRSQDTSLYVPLPILDRPWDMVSMDFVLVLPKTERGND*IYVVVD
D5ABB2_______________KLRHDVSKYIRSCSACSIAKPAIKKQGLYTPLPTLDRPWESISMDYMSGLPSTKHGNDYVFVVVD

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain